close all open/close all

CDS information : Rimoc_00070


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction9,125 / 9,316 / + [in whole cluster]
9,125 / 9,316 / + [in contig]
Location9125..9316 [in whole cluster]
9125..9316 [in contig]
TypeCDS
Length192 bp (63 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)RimH
Gene
Gene (GenBank)rimH
EC number
Keyword
Note
Note (GenBank)
  • ferredoxin
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
Related Reference
ACC
P18324
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [RimH]
MRITVDSDRCVGAGQCVLNAPAVFDQDDDGLVTLLAEPGADQEAAAKLAGALCPSGAITV
HEG
selected fasta
>putative ferredoxin [RimH]
ATGCGTATCACCGTTGACTCCGACCGCTGCGTCGGGGCGGGCCAGTGCGTACTGAACGCG
CCCGCGGTCTTCGACCAGGACGACGACGGGCTCGTCACCCTTCTCGCCGAGCCCGGCGCC
GACCAGGAGGCCGCCGCCAAACTGGCCGGTGCCCTGTGCCCGTCCGGGGCCATCACCGTG
CACGAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  1.10000029896148e-05 PR00352 [16-26]  1.10000029896148e-05 PR00352 [46-58]  1.10000029896148e-05 PR00352
PR00352   3FE4SFRDOXIN
IPR010693 Ferredoxin soy-like (Family)
 [1-61]  3.90000000000001e-15 PF06902
PF06902   DUF1271
IPR017896 4Fe-4S ferredoxin-type, iron-sulpur binding domain (Domain)
 [1-29]  PS51379
PS51379   4FE4S_FER_2
SignalP No significant hit
TMHMM No significant hit