close all open/close all

CDS information : Rimoc_00080


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction9,397 / 14,610 / + [in whole cluster]
9,397 / 14,610 / + [in contig]
Location9397..14610 [in whole cluster]
9397..14610 [in contig]
TypeCDS
Length5,214 bp (1,737 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)RimA
Gene
Gene (GenBank)rimA
EC number
Keyword
Note
Note (GenBank)
  • type I polyketide synthase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
[21821762] Initiation of polyene macrolide biosynthesis: interplay between polyketide synthase domains and modules as revealed via domain swapping, mutagenesis, and heterologous complementation. (Appl Environ Microbiol. , 2011)

close this sectionPKS/NRPS Module

0 acetyl-CoA for CE-108
butyryl-CoA for Rimocidin
CoL51..457
ACP557..634
KS661..1037
AT1193..1517
ACP1592..1662

close this sectionSequence

selected fasta
>polyketide synthase [RimA]
MVPVHTADYVIQPPTDAAEVRGGHTLPEVFETASRAAPDAVAIVDGDRSRTWAQWRADVR
ALARGLQESGVGPGDVVAVRLPNSWEFQTLHLAVAAVGAVLLPVHEGTPTAEVHALLTRA
EPVLLVLSASGSEGTATARSLLESVPTLRGVLLAGASEAECEEPGIGALDGLRAAWTGSE
PRPVHLTPDMPLALIPSSGTTSARPKLCVHTHGGLLANTAAVVADAADAFGGTVLTACPM
THLFGLQSLHTALFAARTQVLLTGWDVDRFLELAREHNPRVVFAVPAQLRDIVARLARAG
EPAGFAPHQVRTAGAALAPALAAQIRAALDCEPVVVWGMSEIGTGTATRAHHPDGSVGEP
VDGVRVRVVDEHGAECAAGETGELQYQGPAMFRGYFREPELTRSALTDDGWLRTGDIAAI
DADGVVVLHGRAAEVIATGGRKFGATEIESLLAELAGLGPLAVAGAPDDRLGEYPCLVVT
DRADRTIGLTEVTAFLRRRGLADHKIPLELVTVRELPFTPAGKLDRRALKEQLRTGLEAT
PVAARLGAVPPETAEEALELVRDCVGQVLGSSGDPAGPAVGAPEFPDTEFRRLGLDSVLA
VRLRNLLREETGLSLPVTLAFDFPTPRAVAHALAEQNDPASAAASGKTAEEARRFPADEA
DPVAIVAMACRLPGGADSPDALWELLAGGTDAMRPFPDDRGWDLDRLFDEDPDRPGTCYA
REGGFLPGAGDFDAGFFGLSDHEATATDPQQRLLLVAAWETFERAGIDPASLKGTRTGVF
TGAMERGYGALASAVPSEWESTLTTGAANSAISGRIAYTYGLEGPALTVDTASSSSLVAL
HLACRSLRSGETDLALAGGVTVMATPAPFTHFARLRALATDSRAKAYADTANGSAWAEGA
GLLLLERLSDARRNGHRVLALVRGSAVNQDGASNGLTAPSGPAQQRVIRQALADAGLTPR
DVDAVEGHGTGTPLGDPIEAQALMATYGQERPEGRPLWLGSVKSNLGHTQAAAGVVGVIK
TVLALGRGVLPRTLHVETPSTKVDWSAGAVRLLTEAQPWPQESGHTRRAGVSSFGLTGTN
AHVILEEAPDGTQSAPGSEPADDTAVPWVLSARSRTALREQARRLAEHVTAHPGLRTQDI
AHALATTRTRHRHRAVVSGSDRDRMLSATAAFGRGERAADVTPLDSAPGGLAFVFSGQGG
QHPGMGRGAAEAFPVFGEALREVCDTLDPLLARPLTSVMWADADSEEATLLHNAEFSQPS
LFALQVALYRLYESWGMAPDRLAGHSAGEIAAAHVTGILTLQDACALVASRGRLISSLPV
GGATVAVRISEDEVRGWLAEETTGSVSIAAVNGPHSLVLSGAEAPLIALTDRLRDAGHKT
HRIPMRVAAHSPLMDPILGEFRAVVRTLAYGTPTIPLVSTVTGRPLTDEEARDPEHWVRH
VRRPVRFKDAIGRLREERVTGFLELGAEPLLTPMIDECLEAAGPQHGTAVVPSLSSGVPD
RQILLSAAARVHTHGAPVDWDAVLPGARPVDLPTYAFQRRRFWLAAGPGAAAEAGFVGAA
IGAGAPAADAEEPSGLEARLAGLEDAEQDAYVRSLVLAETSAVLGGQEPLDSEGTHTFKE
MGINSVNAVELRNRLIAATDLRLPATLVYDHPTPNAVVRLVRERLARPATAARDVDSVVA
ELESLLTAGAEVSAEAVARLKAMAAGRDGTTDTGSGGPLDLTSASDEDLFRLMDAEH
selected fasta
>polyketide synthase [RimA]
ATGGTGCCCGTCCACACAGCTGACTACGTGATCCAGCCGCCCACCGACGCGGCGGAGGTA
CGGGGCGGCCACACGCTGCCCGAGGTGTTCGAGACCGCGTCGAGGGCCGCCCCCGACGCG
GTGGCCATCGTGGACGGGGACCGTTCGCGGACCTGGGCGCAGTGGCGGGCGGACGTCCGC
GCGCTGGCCCGTGGCCTCCAGGAATCGGGCGTCGGGCCCGGTGACGTGGTGGCGGTGCGG
CTGCCGAACAGCTGGGAGTTCCAGACCCTGCACCTGGCCGTCGCGGCCGTCGGCGCCGTA
CTGCTGCCCGTCCACGAGGGCACCCCGACCGCGGAGGTCCACGCGCTGCTGACCCGCGCG
GAACCCGTACTCCTCGTCCTGTCGGCTTCCGGGAGCGAGGGCACGGCAACGGCCCGCTCG
CTCCTGGAGAGCGTGCCGACGCTGCGCGGCGTGCTGCTGGCCGGGGCGTCGGAGGCGGAG
TGCGAGGAGCCGGGGATCGGGGCGCTGGACGGGTTGCGGGCAGCCTGGACGGGCAGCGAG
CCCCGGCCGGTGCACCTCACCCCCGACATGCCGCTCGCCCTGATCCCCTCGTCCGGCACC
ACCTCGGCGCGGCCCAAGCTGTGCGTGCACACCCACGGCGGCCTGCTGGCGAACACCGCG
GCCGTCGTGGCCGATGCCGCCGACGCCTTCGGCGGCACGGTCCTGACCGCCTGCCCGATG
ACCCACCTGTTCGGGCTCCAGTCCCTGCACACGGCGCTGTTCGCCGCCCGGACGCAGGTC
CTGCTCACCGGCTGGGACGTGGACCGCTTCCTGGAGCTGGCGCGGGAGCACAACCCCCGC
GTCGTCTTCGCCGTACCCGCCCAACTGCGGGACATCGTCGCGCGACTCGCCAGGGCGGGC
GAGCCGGCGGGCTTCGCGCCGCACCAGGTGCGTACGGCGGGCGCCGCCCTCGCACCCGCG
CTCGCCGCACAGATACGCGCCGCCCTCGACTGCGAACCGGTCGTGGTGTGGGGCATGTCC
GAGATCGGCACCGGCACCGCAACCCGGGCCCACCACCCCGACGGCAGCGTGGGAGAACCG
GTCGACGGCGTGCGCGTACGGGTCGTCGACGAGCACGGCGCGGAGTGCGCGGCGGGGGAG
ACGGGCGAGCTCCAGTACCAGGGCCCGGCGATGTTCCGCGGCTATTTCCGCGAGCCGGAG
CTGACGCGCTCGGCCCTCACCGACGACGGCTGGCTGCGGACCGGCGACATCGCCGCCATC
GACGCGGACGGCGTGGTCGTCCTGCACGGCCGGGCGGCCGAAGTGATCGCCACCGGAGGC
CGGAAGTTCGGCGCCACCGAAATCGAGAGCCTGCTCGCGGAGCTCGCGGGCCTGGGCCCG
CTGGCCGTGGCGGGGGCGCCGGACGACCGGCTCGGCGAGTACCCGTGCCTGGTCGTGACC
GACCGCGCGGACCGTACGATCGGGCTGACCGAGGTGACCGCGTTCCTGCGCCGGCGGGGA
CTCGCCGACCACAAGATCCCCCTCGAACTGGTCACCGTGCGCGAGCTGCCCTTCACCCCC
GCGGGGAAGCTCGACCGCAGGGCACTCAAGGAGCAGCTGCGCACCGGCCTGGAAGCGACG
CCCGTGGCGGCCCGTCTCGGCGCGGTCCCGCCGGAGACGGCCGAAGAGGCGCTGGAACTG
GTACGCGACTGCGTCGGCCAGGTCCTCGGCAGCAGCGGCGACCCGGCCGGCCCCGCCGTC
GGTGCGCCGGAATTCCCCGACACCGAATTCCGCCGGCTCGGCCTCGACTCCGTCCTCGCG
GTGCGGCTGCGCAACCTGCTGCGGGAGGAGACCGGGCTGTCCCTCCCGGTCACGCTGGCC
TTCGACTTCCCGACGCCGCGGGCCGTGGCGCACGCACTGGCCGAGCAGAACGACCCGGCT
TCGGCGGCGGCATCGGGGAAGACGGCGGAGGAGGCGCGGAGGTTCCCGGCCGACGAGGCC
GATCCGGTGGCGATCGTCGCCATGGCCTGCCGCCTGCCGGGCGGCGCCGACTCTCCCGAC
GCCCTGTGGGAGCTGCTGGCCGGCGGAACCGACGCGATGCGGCCCTTCCCGGACGACCGC
GGCTGGGACCTGGACCGCCTCTTCGACGAGGACCCCGACCGGCCGGGCACCTGCTACGCA
CGCGAAGGCGGCTTCCTGCCCGGCGCGGGCGACTTCGACGCGGGCTTCTTCGGCCTGTCC
GACCACGAGGCGACGGCCACCGACCCGCAGCAGCGCCTGCTCCTGGTGGCGGCCTGGGAG
ACCTTCGAGCGGGCGGGCATCGACCCGGCGTCCCTGAAGGGCACCCGTACGGGCGTGTTC
ACCGGCGCGATGGAGCGCGGCTACGGCGCTCTCGCGTCCGCCGTCCCCAGCGAGTGGGAG
AGCACGCTCACCACCGGGGCCGCCAACAGCGCGATCTCCGGGCGCATCGCCTACACCTAC
GGCCTCGAAGGCCCCGCGCTGACCGTCGACACCGCCTCCTCGTCCTCCCTCGTCGCCCTG
CACCTGGCCTGCCGCTCCCTGCGGTCGGGCGAGACCGACCTGGCGCTGGCCGGCGGCGTC
ACCGTCATGGCGACCCCGGCGCCCTTCACCCACTTCGCCCGGCTGCGCGCGCTCGCCACC
GACTCGCGCGCCAAGGCGTACGCGGACACCGCGAACGGCTCCGCGTGGGCGGAAGGCGCG
GGACTGCTGCTGCTGGAGCGGCTGAGCGACGCCCGCCGCAACGGACACCGTGTACTGGCG
CTCGTACGGGGCTCGGCGGTCAACCAGGACGGCGCCTCCAACGGGCTCACCGCCCCGAGC
GGCCCCGCGCAGCAGCGCGTCATCCGCCAGGCCCTGGCCGACGCCGGTCTGACGCCGCGG
GACGTGGACGCGGTGGAGGGGCACGGCACCGGCACTCCGCTCGGCGACCCGATCGAGGCC
CAGGCCCTGATGGCCACCTACGGCCAGGAGCGGCCGGAGGGACGGCCGCTGTGGCTGGGG
TCGGTGAAGTCCAACCTCGGGCACACACAGGCCGCTGCCGGGGTCGTCGGGGTCATCAAG
ACGGTGCTCGCGCTGGGCCGCGGCGTCCTGCCCAGGACGCTGCACGTGGAGACTCCTTCC
ACCAAGGTCGACTGGTCCGCCGGGGCGGTACGGCTGCTGACCGAGGCGCAGCCCTGGCCC
CAGGAGAGCGGGCACACGCGGCGGGCAGGAGTGTCGTCCTTCGGGCTCACCGGCACCAAC
GCCCACGTGATCCTGGAGGAGGCCCCGGACGGGACGCAGAGCGCGCCCGGATCGGAACCG
GCCGACGACACCGCCGTACCGTGGGTGCTCTCCGCACGGAGCCGGACGGCGCTGCGCGAA
CAGGCCCGCCGCCTGGCCGAGCACGTGACCGCTCACCCCGGCCTGCGCACACAGGACATC
GCCCACGCCCTGGCCACCACCCGCACCCGGCACCGGCACCGGGCCGTCGTCAGCGGCTCC
GACCGGGACCGGATGCTGTCCGCGACGGCCGCGTTCGGGCGCGGGGAGCGGGCCGCGGAC
GTCACCCCGCTCGATTCCGCGCCGGGCGGCCTGGCCTTCGTCTTCTCCGGACAGGGCGGC
CAGCACCCCGGCATGGGGCGCGGGGCGGCCGAGGCGTTCCCCGTGTTCGGGGAGGCGCTG
CGCGAGGTGTGCGACACCCTCGACCCGCTGCTGGCACGTCCGCTGACCTCGGTGATGTGG
GCGGACGCCGACTCCGAGGAGGCGACGCTGCTGCACAACGCCGAGTTCTCGCAGCCCTCG
CTGTTCGCCCTCCAGGTCGCCCTCTACCGGCTGTACGAGTCCTGGGGCATGGCCCCGGAC
CGTCTCGCGGGCCATTCGGCCGGCGAGATCGCCGCCGCGCATGTCACCGGCATCCTCACC
CTCCAGGACGCCTGCGCCCTGGTGGCCTCCCGGGGCAGGCTGATCAGCTCGCTGCCGGTC
GGCGGCGCGACGGTGGCGGTGCGCATCTCGGAGGACGAGGTGCGGGGGTGGCTCGCCGAG
GAGACGACCGGCTCGGTCTCGATCGCGGCCGTCAACGGGCCGCACTCCCTCGTACTCTCC
GGTGCCGAGGCCCCGCTCATCGCCCTCACGGACCGGCTCCGCGACGCCGGCCACAAGACC
CACCGCATCCCCATGAGGGTCGCGGCCCACTCACCGCTGATGGACCCCATCCTGGGGGAG
TTCCGCGCGGTCGTCCGCACGCTGGCCTACGGCACGCCCACCATCCCCCTCGTCTCCACC
GTCACCGGCCGCCCGCTGACCGACGAGGAGGCGCGCGACCCTGAGCACTGGGTACGGCAC
GTGCGGCGGCCCGTGCGCTTCAAGGACGCGATCGGCCGGCTCCGGGAGGAGCGCGTCACC
GGCTTCCTGGAGCTGGGCGCCGAGCCGCTGCTCACCCCCATGATCGACGAGTGCCTGGAG
GCGGCCGGCCCGCAGCACGGAACCGCCGTGGTGCCGAGCCTGAGCTCCGGCGTACCGGAC
CGGCAGATCCTGCTCTCCGCGGCCGCCCGGGTGCACACCCACGGCGCACCCGTCGACTGG
GACGCGGTGCTGCCCGGGGCCCGGCCCGTCGACCTGCCGACGTACGCGTTCCAGCGGCGG
CGGTTCTGGCTGGCGGCGGGGCCGGGTGCGGCCGCCGAGGCCGGTTTCGTGGGTGCCGCG
ATCGGCGCGGGCGCGCCGGCGGCCGATGCGGAGGAGCCGTCGGGCCTGGAAGCCCGGCTG
GCCGGTCTCGAAGACGCCGAACAGGACGCGTACGTACGCTCCCTGGTGCTCGCCGAGACC
TCGGCCGTGCTCGGCGGCCAGGAACCGCTCGACAGCGAAGGCACCCACACCTTCAAGGAG
ATGGGCATCAACTCGGTGAACGCCGTCGAGCTCCGCAACCGCCTCATCGCGGCCACGGAC
CTGCGGCTCCCCGCCACGCTCGTCTACGACCACCCCACCCCGAACGCGGTCGTCCGCCTC
GTACGCGAACGCCTCGCGCGCCCGGCCACCGCCGCACGCGACGTGGACTCGGTCGTGGCC
GAGCTGGAGTCCCTGCTCACGGCCGGCGCGGAGGTCTCGGCGGAGGCGGTGGCACGGCTG
AAGGCGATGGCGGCGGGGCGGGACGGCACTACGGACACCGGTTCCGGCGGGCCCCTGGAC
CTGACGTCGGCCAGCGACGAGGACCTGTTCCGGCTGATGGACGCGGAGCACTGA
[0] CoL51..457
[0] ACP557..634
[0] KS661..1037
[0] AT1193..1517
[0] acetyl-CoA for CE-108 butyryl-CoA for Rimocidin1387..1391
[0] ACP1592..1662
[0] CoL151..1371
[0] ACP1669..1902
[0] KS1981..3111
[0] AT3577..4551
[0] acetyl-CoA for CE-108 butyryl-CoA for Rimocidin4159..4173
[0] ACP4774..4986

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [51-457]  3.70000000000004e-77 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1189-1318]  1.10000000000001e-70 G3DSA:3.40.366.10 [1387-1506]  1.10000000000001e-70 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [592-607]  PS00012 [1620-1635]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [557-634]  PS50075 [1592-1662]  PS50075
PS50075   ACP_DOMAIN
 [555-636]  4.2e-28 G3DSA:1.10.1200.10 [1595-1666]  3.60000000000001e-30 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [586-632]  3.7e-09 PF00550 [1596-1661]  1.1e-07 PF00550
PF00550   PP-binding
 [550-677]  1.60000240695997e-21 SSF47336 [1583-1669]  9.40001006865064e-15 SSF47336
SSF47336   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [661-911]  1.29999999999998e-87 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [919-1037]  3.80000000000003e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1193-1517]  1.29999999999998e-56 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1190-1486]  2.19999900980707e-61 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1320-1386]  1.20000117458134e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [663-923]  6.7999999999999e-83 G3DSA:3.40.47.10 [924-1090]  2.30000000000004e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [653-1035]  2.1000026783403e-95 SSF53901
SSF53901   Thiolase-like
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1194-1498]  3.60002015031011e-106 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [558-637]  6.59999852526376e-23 SM00823 [1593-1665]  1.50000306971104e-22 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [663-1090]  SM00825
SM00825   PKS_KS
SignalP
 [1-17]  0.044 Signal
Eukaryota   
TMHMM No significant hit