close all open/close all

CDS information : Rimoc_00090


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction16,367 / 14,688 / - [in whole cluster]
16,367 / 14,688 / - [in contig]
Locationcomplement(14688..16367) [in whole cluster]
complement(14688..16367) [in contig]
TypeCDS
Length1,680 bp (559 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)ORF1
Gene
Gene (GenBank)orf1
EC number
Keyword
Note
  • This ORF is not involved in polyene productions.
Note (GenBank)
  • transposase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative transposase [ORF1]
MSMRPSGPGEIPAETVRVARAAFAKGSLAIRVRDELGPMFRDEDFADLFASRGRPAWSPA
GLALVSVLQFVDGLTDRQAAEAVRARIDFKYALGLELGDPGFDFSVLSEFRDRLAGADGG
RRVMDGVLVAAREKGLLKSAGRARTDSTHILSSARQLNWLELVAETLRSALNALAQAAPG
WLAEAAEPDWFRHYATRAEESRFPKGRARRDEVGLRIGRDGMRLLEEVFATVAPHRLRAL
DEVEILRQVWVQHFHMVEGEVARRDPKDRPPGMMRLVTPYDREARGSVKRDIMWDGYKVH
LTEICEADAPNLITNVATTVATVSDSVMSQSIHAGLADRDCLPGEHWVDAGYPTATQVLA
ARTEHGVALHGPMAANTSAQSAGPYGLDAFTVDWDQQQVACPGGVTTTQWYPRTDSKGLA
VIRVRFRHSECRPCPHRHECVGSATGQRREIMLRHREEHEIIRHSRAEQQTDAWKDRYKI
RAGVEGSISQAVGRCGLRRSRYRGLTKTSLQHQLTGAAINLARIDAHLTGTPRARTRTSH
FAALCPAEMTLDGAQAGTE
selected fasta
>putative transposase [ORF1]
ATGTCGATGCGTCCGAGTGGGCCGGGGGAGATTCCGGCGGAGACGGTGCGGGTGGCCCGG
GCGGCGTTTGCGAAGGGAAGCCTGGCGATCCGGGTCCGGGACGAGCTGGGGCCGATGTTC
CGGGACGAGGACTTCGCGGATCTGTTCGCCTCACGAGGCCGGCCTGCCTGGTCTCCGGCC
GGTCTGGCGCTGGTGTCGGTGCTCCAGTTCGTGGACGGGCTGACCGACCGCCAGGCCGCG
GAAGCGGTGCGGGCGCGGATCGACTTCAAGTACGCCCTCGGGCTGGAACTGGGCGATCCC
GGCTTCGACTTCTCGGTGCTGTCGGAGTTCAGGGACCGGCTGGCCGGGGCCGATGGAGGG
CGCCGGGTCATGGACGGTGTGCTGGTGGCAGCCCGCGAGAAGGGGCTGCTCAAGAGCGCG
GGCCGGGCCCGCACCGACTCCACGCACATCTTGTCCTCGGCACGGCAGCTGAACTGGCTG
GAGCTGGTCGCGGAGACGCTGCGATCGGCTCTGAACGCACTGGCCCAGGCTGCCCCCGGC
TGGCTGGCCGAAGCCGCCGAGCCGGACTGGTTCCGGCACTACGCGACCCGGGCCGAGGAG
TCCCGGTTCCCCAAGGGCCGTGCCAGGCGGGACGAGGTGGGCCTGCGGATCGGCAGGGAC
GGGATGCGGCTGCTGGAGGAGGTCTTCGCCACCGTTGCACCGCACCGGCTTCGCGCACTC
GATGAGGTGGAGATCCTGCGGCAGGTCTGGGTCCAGCACTTCCACATGGTGGAGGGCGAG
GTGGCCAGGCGGGACCCAAAAGACCGTCCGCCGGGCATGATGCGCCTGGTCACCCCGTAT
GACCGCGAGGCCCGTGGCAGCGTGAAGCGGGACATCATGTGGGACGGCTACAAGGTCCAT
CTCACCGAGATCTGCGAGGCGGACGCCCCGAACCTGATCACGAACGTGGCCACCACCGTC
GCCACCGTCTCGGACAGCGTGATGAGCCAGTCGATCCACGCGGGCCTCGCCGACCGCGAC
TGCCTGCCCGGCGAACACTGGGTCGATGCCGGTTATCCCACCGCCACTCAAGTCCTGGCC
GCCCGCACCGAGCATGGCGTCGCGCTGCACGGGCCCATGGCTGCCAACACGTCCGCCCAG
TCCGCGGGCCCCTACGGCCTGGACGCATTCACCGTCGACTGGGACCAGCAGCAGGTGGCC
TGCCCCGGCGGCGTCACCACGACCCAGTGGTATCCGCGCACGGACTCCAAGGGCCTCGCG
GTCATCCGCGTGCGGTTCCGCCACAGCGAGTGTCGCCCCTGTCCCCACCGGCACGAGTGC
GTGGGCTCGGCTACCGGCCAGCGCCGGGAGATCATGCTGCGTCACCGGGAGGAACACGAG
ATCATCCGACACAGCCGCGCCGAGCAGCAAACCGATGCCTGGAAGGACCGTTACAAGATC
CGTGCCGGGGTCGAGGGCAGCATCTCCCAAGCAGTCGGGCGCTGCGGCCTGCGCAGATCC
CGCTACCGGGGCCTGACAAAGACCAGCCTCCAGCACCAGCTCACCGGAGCCGCGATCAAC
CTTGCCCGCATCGACGCCCACCTCACCGGCACACCCCGAGCCCGCACCCGCACCAGCCAC
TTCGCAGCACTGTGCCCCGCCGAGATGACGCTCGACGGGGCACAAGCAGGGACCGAATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008490 Transposase InsH, N-terminal (Domain)
 [53-126]  1.2e-14 PF05598
PF05598   DUF772
SignalP
 [1-29]  0.12 Signal
Eukaryota   
 [1-24]  0.211 Signal
Bacteria, Gram-negative   
 [1-24]  0.267 Signal
Bacteria, Gram-positive   
TMHMM No significant hit