close all open/close all

CDS information : Rimoc_00100


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction17,843 / 16,497 / - [in whole cluster]
17,843 / 16,497 / - [in contig]
Locationcomplement(16497..17843) [in whole cluster]
complement(16497..17843) [in contig]
TypeCDS
Length1,347 bp (448 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase
Product (GenBank)RimJ
Gene
Gene (GenBank)rimJ
EC number1.3.1.-
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • crotonyl-CoA reductase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
[26284936] New Rimocidin/CE-108 Derivatives Obtained by a Crotonyl-CoA Carboxylase/Reductase Gene Disruption in Streptomyces diastaticus var. 108: Substrates for the Polyene Carboxamide Synthase PcsA. (PLoS One. , 2015)
Related Reference
ACC
Q53865
PmId
[8521864] Purification of crotonyl-CoA reductase from Streptomyces collinus and cloning, sequencing and expression of the corresponding gene in Escherichia coli. (Eur J Biochem. , 1995)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase [RimJ]
MKEILNAIQAPDTTAADFAALPLPESYRAITVHKDETDMFEGLAGCDKDPRKSLHLDEVA
VPELGPGEALVAVMASSVNYNSVWTSIFEPLPTFGFLERYGRRSELAKRHDLPYHVIGSD
LAGVVLRTGPGVTVWKPGDEVVAHCLSVELESADGHGDTMLDPEQRIWGFETNFGGLAEL
ALVKSNQLMPKPGHLTWEEAAASGLVNSTAYRQLVSRNGAGMKVGDNVLIWGASGGLGSY
ATQLVLAGGGTPVCVVSNDQKAEICRSMGAEAVIDRNAEGYRFWKDEQTQDPREWKRFGK
RIRELTGGEDVDIVFEHPGRETFGASVFVTRKGGTVVTCASTSGYQHQYDNRYLWMSLKR
IVGSHFANYREAWEANRLIAKGRIHPTLSQTYPLRETGQAAYDVHRNLHQGKVGILALAP
EEGLGVRDAEFRARHASAINRFRGTLED
selected fasta
>putative crotonyl-CoA reductase [RimJ]
GTGAAGGAAATACTGAACGCTATTCAGGCGCCGGACACCACGGCCGCCGACTTCGCCGCG
CTGCCGCTGCCCGAGTCGTACCGCGCGATCACCGTCCACAAGGACGAGACCGACATGTTC
GAGGGGCTCGCGGGGTGCGACAAGGACCCGCGCAAGTCGCTGCACCTCGACGAGGTGGCC
GTCCCCGAACTCGGTCCCGGCGAGGCCCTGGTGGCCGTCATGGCGTCCTCGGTGAACTAC
AACAGCGTCTGGACCTCGATCTTCGAGCCGCTGCCGACGTTCGGGTTCCTGGAGCGGTAC
GGCCGGCGCAGCGAGCTCGCCAAGCGGCACGACCTGCCGTACCACGTCATCGGCTCCGAC
CTGGCGGGCGTCGTGCTGCGCACCGGGCCCGGCGTCACCGTCTGGAAGCCCGGTGACGAG
GTCGTCGCGCACTGCCTGTCCGTCGAGCTGGAGAGCGCGGACGGCCACGGTGACACGATG
CTCGACCCCGAGCAGCGCATCTGGGGCTTCGAGACCAATTTCGGCGGTCTCGCCGAACTC
GCGCTGGTGAAGTCGAATCAGCTGATGCCCAAGCCCGGCCATCTCACGTGGGAGGAGGCG
GCGGCCTCCGGGCTGGTGAATTCCACCGCGTACCGCCAGCTGGTGTCCCGCAACGGCGCG
GGCATGAAGGTCGGTGACAATGTGCTGATCTGGGGCGCGAGCGGCGGACTCGGTTCGTAC
GCGACGCAGTTGGTGCTGGCCGGCGGCGGCACACCCGTCTGTGTGGTGTCCAACGACCAG
AAGGCGGAGATCTGCCGGTCCATGGGCGCGGAAGCGGTCATCGACCGCAACGCCGAGGGG
TACCGGTTCTGGAAGGACGAGCAGACGCAGGACCCCCGGGAGTGGAAGCGGTTCGGCAAG
CGCATCCGCGAGCTGACCGGCGGCGAGGACGTGGACATCGTTTTCGAGCACCCGGGGCGG
GAGACGTTCGGCGCGAGTGTGTTCGTCACGCGCAAGGGCGGCACGGTCGTCACCTGCGCC
TCCACCTCGGGCTACCAGCACCAGTACGACAACCGCTATCTGTGGATGTCGCTCAAGCGC
ATCGTGGGCTCGCACTTCGCCAACTACCGCGAGGCGTGGGAGGCCAACCGCCTGATCGCC
AAGGGCAGGATCCACCCGACGCTGTCCCAGACCTACCCCCTGAGGGAGACCGGGCAGGCG
GCGTACGACGTGCACCGCAACCTCCACCAGGGCAAGGTCGGCATTCTGGCGCTCGCTCCC
GAGGAAGGACTCGGCGTACGGGACGCCGAGTTCCGGGCGCGGCACGCCAGCGCCATCAAC
CGCTTCCGCGGGACGCTGGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010085 Crotonyl-CoA reductase (Family)
 [31-428]  TIGR01751
TIGR01751   Crot-CoA-red
IPR011032 GroES-like (Domain)
 [39-233]  1.29999924468179e-28 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [236-380]  6.90000000000001e-39 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [113-190]  9.7e-07 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [232-364]  5.5e-21 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit