close all open/close all
Rimoc_00100 Rimoc_00100   last last

CDS information : Rimoc_00110


close this sectionLocation

Organism
Strain108
Entry nameRimocidin
Contig
Start / Stop / Direction18,550 / 18,149 / - [in whole cluster]
18,550 / 18,149 / - [in contig]
Locationcomplement(18149..18550) [in whole cluster]
complement(18149..18550) [in contig]
TypeCDS
Length402 bp (133 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acetyltransferase
Product (GenBank)RimK
Gene
Gene (GenBank)rimK
EC number
Keyword
Note
Note (GenBank)
  • acetyltransferase
Reference
ACC
PmId
[15123265] Starter unit choice determines the production of two tetraene macrolides, rimocidin and CE-108, in Streptomyces diastaticus var. 108. (Chem Biol. , 2004)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [RimK]
MAITYEWRGDFENAAVNRLHAEGFGHRGLDIDWVAQVHRHSLGWVCARRDRDGELVGFVN
VAWDGGVHAFVLDTVVTADMRRSGIGAGLVAAAVGGARAARCEWLHVDFDDELRTFYFDA
CGFQPTNAGLIAL
selected fasta
>putative acetyltransferase [RimK]
ATGGCGATCACGTACGAGTGGCGGGGCGACTTCGAGAACGCGGCCGTCAACCGGCTGCAC
GCGGAGGGCTTCGGCCACCGGGGCCTGGACATCGACTGGGTGGCGCAGGTCCACCGGCAC
AGTCTCGGCTGGGTGTGCGCCCGGCGCGACCGTGACGGTGAACTCGTCGGCTTCGTCAAT
GTCGCGTGGGACGGTGGTGTCCACGCGTTCGTCCTGGACACCGTGGTGACGGCGGACATG
CGCCGTTCCGGGATCGGTGCCGGGCTGGTCGCCGCGGCCGTCGGGGGCGCCCGGGCGGCG
CGGTGCGAATGGCTGCACGTCGACTTCGACGACGAACTGCGCACGTTCTACTTCGACGCC
TGCGGGTTCCAGCCGACGAACGCGGGTCTCATCGCACTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [1-133]  PS51186
PS51186   GNAT
 [51-123]  2e-06 PF00583
PF00583   Acetyltransf_1
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [1-127]  1.80000149287196e-11 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [31-126]  3.3e-12 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
SignalP
 [1-43]  0.036 Signal
Eukaryota   
 [1-35]  0.028 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Rimoc_00100 Rimoc_00100   last last