close all open/close all

CDS information : Rubra_00020


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction2,157 / 1,141 / - [in whole cluster]
2,157 / 1,141 / - [in contig]
Locationcomplement(1141..2157) [in whole cluster]
complement(1141..2157) [in contig]
TypeCDS
Length1,017 bp (338 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-glucose 4,6-dehydratase
Product (GenBank)putative TDP-glucose dehydratase
Gene
Gene (GenBank)rubN2
EC number4.2.1.46
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[9387157] Identification of a gene cluster of biosynthetic genes of rubradirin substructures in S. achromogenes var. rubradiris NRRL3061. (Mol Cells. , 1997)
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>dTDP-glucose 4,6-dehydratase [putative TDP-glucose dehydratase]
MKLLVTGGAGFIGSHYVRQLLAGGYPGYEQARITVLDVLSYAGRRDNLPVDHPRMDFVQG
DICDIPLLLDLLPGHDAVVHFAAESHVDRSVRSAAEFVRTNVAGTQALLEASVRRGISRF
VHVSTDEVYGSTDEGSWTEDAPLLPNSPYAASKASADLITRAYWRTHGLDVSITRCSNNY
GPYQFPEKLIPLFVTNLMEGKPVPLYGDGYNVREWLHVADHCRAVQAVLTSGGAGEIYNI
GGGTGHTNLELTERLLELCGSDRSMIRFVADRKGHDLRYALDDSKIREQLGYSPRVSFDR
GLAETVAWYRDNPGWWKTVDGRRAADGEHDTTGGAAPS
selected fasta
>dTDP-glucose 4,6-dehydratase [putative TDP-glucose dehydratase]
ATGAAACTCCTGGTAACAGGCGGTGCCGGATTCATCGGCTCGCACTATGTACGGCAACTG
CTCGCCGGCGGATATCCCGGCTACGAACAGGCCCGGATCACCGTGCTCGACGTGCTGAGC
TACGCCGGACGCAGGGACAACCTGCCGGTCGACCATCCGCGGATGGACTTCGTGCAGGGC
GACATCTGCGACATCCCCCTGCTGCTCGACCTGTTGCCGGGCCACGACGCGGTGGTGCAT
TTCGCCGCGGAATCGCACGTGGATCGCTCGGTGCGCTCCGCCGCCGAGTTCGTACGGACC
AATGTCGCCGGCACCCAGGCCCTCCTGGAGGCGTCTGTGCGCCGTGGCATATCCCGGTTC
GTCCATGTCTCGACCGACGAGGTGTACGGCTCGACCGACGAAGGATCGTGGACCGAGGAC
GCCCCGCTACTGCCCAACTCGCCCTACGCGGCGTCCAAGGCGAGTGCGGACCTGATCACC
CGCGCGTACTGGCGCACCCACGGACTGGACGTGTCCATCACCCGCTGCTCCAACAACTAC
GGGCCCTACCAGTTCCCCGAGAAACTGATCCCGCTGTTCGTGACGAACCTCATGGAGGGC
AAGCCCGTTCCGCTCTACGGCGATGGATACAACGTGCGCGAGTGGCTGCATGTGGCCGAC
CACTGCCGGGCCGTGCAGGCGGTACTCACCTCAGGCGGGGCAGGAGAGATCTACAACATC
GGGGGCGGCACGGGCCACACCAACCTGGAGCTCACCGAGCGACTGCTGGAGCTGTGCGGA
TCGGACCGCTCGATGATCCGGTTCGTCGCCGACCGCAAGGGCCACGACCTGCGCTACGCA
CTCGACGACAGCAAGATCCGCGAGCAGCTGGGGTACAGCCCGCGCGTCTCGTTCGACCGG
GGACTGGCCGAGACCGTCGCCTGGTACAGGGACAACCCCGGGTGGTGGAAGACGGTGGAC
GGCCGCCGCGCCGCGGACGGGGAGCACGACACCACCGGAGGCGCAGCCCCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-241]  4.49999999999996e-69 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-319]  1.29999999999998e-127 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-186]  3.70000000000004e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-31]  0.127 Signal
Bacteria, Gram-negative   
TMHMM No significant hit