close all open/close all

CDS information : Rubra_00030


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction3,502 / 2,741 / - [in whole cluster]
3,502 / 2,741 / - [in contig]
Locationcomplement(2741..3502) [in whole cluster]
complement(2741..3502) [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52567
NITE
Rifam_00490
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MAGHARRAEDQGFTTLLSADVLTAPSPFPALALAAGATTTLRVGTWVIASPLRAPRMAAW
DAHTLSMLSGGRFDLGIGSGRPFVLEDAERLLGVPTPPAAERLAQVERTIDELRALDGDA
HTPVLIAAGGPKARALAAAKADRVTLAASPFATREEIAARVREVREQAGDRGEEMEFVSP
IYVIGDEAPPWVPRLLKTDMKALIEGDSLNILRGSPREMADELLRRRETLGISCFTVNAV
FAEQFAQVIELLA
selected fasta
>hypothetical protein [hypothetical protein]
GTGGCTGGGCATGCCAGGCGAGCCGAGGACCAGGGGTTCACCACCCTGCTCTCGGCCGAC
GTCCTGACGGCACCGTCACCGTTCCCCGCCCTCGCCCTCGCGGCCGGGGCGACCACGACC
TTGCGGGTGGGAACGTGGGTGATCGCCAGCCCACTGCGCGCGCCGCGCATGGCGGCATGG
GATGCCCACACGCTGTCCATGCTGAGCGGCGGGCGATTCGACCTCGGCATCGGGTCGGGC
CGGCCCTTCGTCCTTGAGGACGCGGAGAGGCTGCTCGGCGTCCCGACACCGCCGGCCGCG
GAACGCCTGGCGCAGGTGGAGAGGACGATCGACGAGCTGCGCGCCCTCGACGGAGACGCG
CACACCCCGGTGCTCATCGCCGCCGGCGGTCCCAAGGCCCGTGCCCTGGCCGCCGCCAAG
GCCGACCGGGTCACGCTCGCCGCGAGCCCGTTCGCCACCCGGGAGGAGATCGCCGCGCGG
GTCAGGGAGGTGCGTGAGCAGGCCGGGGACCGCGGCGAGGAGATGGAGTTCGTCTCCCCG
ATCTACGTCATCGGTGACGAGGCACCGCCGTGGGTTCCCCGTCTGCTGAAGACCGACATG
AAAGCGCTCATCGAGGGCGACTCGCTGAACATCCTGCGCGGCAGCCCACGGGAGATGGCC
GACGAACTGCTGCGCCGCCGCGAGACCCTCGGCATCTCCTGCTTCACCGTGAACGCCGTG
TTCGCCGAACAGTTCGCCCAGGTGATCGAGCTTCTCGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [4-253]  7.89999999999997e-34 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
 [1-253]  1.10000150671643e-36 SSF51679
SSF51679   Luciferase_like
 [2-186]  1.5e-27 PF00296
PF00296   Bac_luciferase
SignalP
 [1-34]  0.607 Signal
Bacteria, Gram-positive   
 [1-34]  0.516 Signal
Eukaryota   
 [1-32]  0.379 Signal
Bacteria, Gram-negative   
TMHMM No significant hit