close all open/close all

CDS information : Rubra_00040


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction4,268 / 4,492 / + [in whole cluster]
4,268 / 4,492 / + [in contig]
Location4268..4492 [in whole cluster]
4268..4492 [in contig]
TypeCDS
Length225 bp (74 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative translation initiation factor IF-1
Product (GenBank)putative translation initiation factor
Gene
Gene (GenBank)rubR1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
P20458
PmId
[2496109] Gene encoding the alpha core subunit of Bacillus subtilis RNA polymerase is cotranscribed with the genes for initiation factor 1 and ribosomal proteins B, S13, S11, and L17. (J Bacteriol. , 1989)

close this sectionSequence

selected fasta
>putative translation initiation factor IF-1 [putative translation initiation factor]
MKKNKTGIEVEGKVVECLRSGMFTVELENGHRVLAHVSGKIRLNFIKVYLEDKVLVELTP
YDLSRGRIVFRYRN
selected fasta
>putative translation initiation factor IF-1 [putative translation initiation factor]
ATGAAGAAGAACAAGACGGGCATCGAAGTCGAGGGCAAGGTCGTCGAGTGCCTGCGCAGC
GGCATGTTCACCGTGGAGCTCGAGAACGGCCACCGGGTGCTCGCTCACGTCAGCGGTAAG
ATCCGCCTGAACTTCATCAAGGTCTATCTGGAAGACAAGGTGCTGGTGGAGCTCACGCCC
TACGACCTGTCACGCGGTCGGATCGTGTTCCGGTACCGGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004368 Translation initiation factor IF-1 (Family)
 [7-72]  2.90000000000001e-30 TIGR00008
TIGR00008   InfA
IPR006196 RNA-binding domain, S1, IF1 type (Domain)
 [1-73]  PS50832
PS50832   S1_IF1_TYPE
 [8-71]  2.7e-21 PF01176
PF01176   eIF-1a
IPR012340 Nucleic acid-binding, OB-fold (Domain)
 [4-72]  3.8e-31 G3DSA:2.40.50.140
G3DSA:2.40.50.140   OB_NA_bd_sub
IPR016027 Nucleic acid-binding, OB-fold-like (Domain)
 [2-72]  2.800005042611e-25 SSF50249
SSF50249   Nucleic_acid_OB
IPR022967 RNA-binding domain, S1 (Domain)
 [5-73]  2.09999806691534e-10 SM00316
SM00316   S1
SignalP
 [1-35]  0.089 Signal
Eukaryota   
TMHMM No significant hit