close all open/close all

CDS information : Rubra_00050


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction5,629 / 4,625 / - [in whole cluster]
5,629 / 4,625 / - [in contig]
Locationcomplement(4625..5629) [in whole cluster]
complement(4625..5629) [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative F420-dependent glucose-6-phosphate dehydrogenase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number1.1.98.2
Keyword
Note
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O68447
PmId
[8631674] Purification of a novel coenzyme F420-dependent glucose-6-phosphate dehydrogenase from Mycobacterium smegmatis. (J Bacteriol. , 1996)
[9555906] Molecular analysis of the gene encoding F420-dependent glucose-6-phosphate dehydrogenase from Mycobacterium smegmatis. (J Bacteriol. , 1998)
[20075070] Glucose 6-phosphate accumulation in mycobacteria: implications for a novel F420-dependent anti-oxidant defense system. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>putative F420-dependent glucose-6-phosphate dehydrogenase [hypothetical protein]
MGLKIGYKASAEQFAPRELVEYAVSAEGHGLDSVWISDHLQPWRHEGGHAPFSLSWLSAV
GERTERVQLGTSVLTATFRYNPAVVAHASATLGVLYPGRIALGIGSGEALNEVAVARITW
PDFKERFARLREAVELIRRLWTEDRVTSEGQYHQTTSVSLYDRPQTPVPIYIAAGGPVMA
KYVGRKSDGFICTSGKGMELYTEKLLPAVEAGADQEGRDHNAIDKMIEIKLSYDPDPDQA
LENCRFWAPLSLTPEQKAGVEDPVKLEKAADELPIGQVAKRWIVASTPDEAITQIKQYVD
AGFNHLVFHGPGHDQERFLKTFAEQVLPGLRGLG
selected fasta
>putative F420-dependent glucose-6-phosphate dehydrogenase [hypothetical protein]
ATGGGACTGAAGATCGGTTACAAGGCATCGGCCGAGCAGTTCGCCCCGCGCGAGCTCGTC
GAGTACGCGGTCAGCGCGGAGGGGCACGGCCTGGACAGTGTCTGGATCAGCGATCACCTG
CAGCCCTGGCGGCACGAGGGCGGCCACGCGCCATTCTCCCTGTCCTGGCTCAGTGCCGTC
GGGGAGCGCACCGAGCGGGTCCAGCTCGGCACCAGCGTGCTGACCGCCACGTTCCGCTAC
AACCCGGCCGTGGTGGCGCACGCGTCCGCCACCCTCGGAGTGCTGTACCCCGGCCGGATC
GCGCTCGGCATAGGCAGCGGTGAGGCCCTCAACGAGGTCGCGGTCGCGCGCATCACCTGG
CCCGATTTCAAGGAGCGGTTCGCCCGCCTGCGCGAGGCCGTGGAGCTGATCCGCCGGCTG
TGGACGGAAGACCGCGTCACATCCGAGGGGCAGTACCACCAGACCACCAGCGTGTCCCTC
TACGACCGGCCCCAAACGCCCGTCCCCATCTACATCGCCGCCGGGGGCCCCGTCATGGCC
AAGTACGTCGGCCGCAAGAGCGACGGCTTCATCTGCACCAGCGGCAAGGGCATGGAGCTG
TACACCGAGAAGCTCCTCCCGGCCGTGGAGGCGGGCGCGGACCAGGAGGGCCGTGACCAC
AACGCGATCGACAAAATGATCGAGATAAAGCTCTCCTACGACCCGGACCCGGACCAAGCG
CTGGAGAACTGCCGGTTCTGGGCGCCGCTTTCGCTAACTCCCGAGCAGAAGGCCGGAGTC
GAGGACCCGGTGAAGTTGGAGAAGGCCGCCGATGAACTGCCCATCGGGCAGGTTGCCAAG
CGCTGGATCGTCGCCTCCACCCCGGACGAGGCGATCACCCAGATCAAGCAGTACGTCGAC
GCCGGGTTCAACCACTTGGTCTTCCACGGCCCCGGGCACGACCAGGAGCGCTTCCTCAAG
ACCTTCGCCGAGCAGGTCCTCCCCGGACTGCGCGGCCTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [6-305]  3.90000000000001e-65 PF00296
PF00296   Bac_luciferase
 [3-331]  9.10000000000013e-84 G3DSA:3.20.20.30
G3DSA:3.20.20.30   Luciferase_like
 [1-332]  5.10003242202156e-82 SSF51679
SSF51679   Luciferase_like
IPR019944 Glucose-6-phosphate dehydrogenase, F420-dependent (Family)
 [3-331]  TIGR03554
TIGR03554   F420_G6P_DH
IPR019945 Glucose-6-phosphate dehydrogenase-related, F420-dependent (Family)
 [5-331]  1.5e-76 TIGR03557
TIGR03557   F420_G6P_family
SignalP No significant hit
TMHMM No significant hit