close all open/close all

CDS information : Rubra_00060


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction5,775 / 7,058 / + [in whole cluster]
5,775 / 7,058 / + [in contig]
Location5775..7058 [in whole cluster]
5775..7058 [in contig]
TypeCDS
Length1,284 bp (427 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)rubP6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
P48635
PmId
[8416893] Identification of a Saccharopolyspora erythraea gene required for the final hydroxylation step in erythromycin biosynthesis. (J Bacteriol. , 1993)
[7849045] Overproduction and characterization of the erythromycin C-12 hydroxylase, EryK. (Biochemistry. , 1995)
ACC
Q2PC42
NITE
Rubra_00480
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MSGRFGPVLRWLASSAESGRTREVSFMSVKQSERILSNFLAYLDGLRERGAVHFDDKIKA
WHVLDYHDVLQVLTDSAAFSSDVAPLAPKQEDFDLFKKGNFVRADDPVHRRLRGLVSRAF
TPKMIAGLEPRITEVTLQLLDDADAGGDQWDLIEQLGYPLPFIVIAEMLGIPVSDRAFVR
RLSDTFFEVHNVDPEQSLDSLGESAVNNVAPLLRELNTHLLEFVRRRRKNPGDDLTSKLL
EVEVDGVRLDDEETVGFLGL-LLAGHVTATSTLGNTVLALHENPEVWTQLRADPALIPAA
VEESMRYRPPFPRLGRQATKDVEIGGQKIPAGAFVLAWLTTANRDDRVFADPDRFDIHRA
PNPHLTFGKGMHFCLRGALARLEVGIALRLLMERYSDIRVRDDLPVNLRNPWAMIGVNQL
PIEVRKG
selected fasta
>putative cytochrome P450 [cytochrome P450]
ATGTCCGGCCGGTTCGGTCCGGTTCTACGGTGGCTGGCGAGTAGCGCGGAATCGGGCCGT
ACGAGAGAAGTGAGTTTCATGAGCGTGAAACAATCCGAACGGATACTGTCCAACTTTCTC
GCCTATCTCGACGGGCTGCGCGAGCGCGGAGCCGTGCACTTCGACGACAAGATCAAGGCG
TGGCACGTACTCGATTACCACGACGTCCTGCAGGTGCTGACCGACTCGGCGGCCTTCTCG
TCCGACGTCGCCCCGCTGGCTCCCAAGCAGGAAGACTTCGATCTGTTCAAGAAGGGCAAC
TTCGTCCGGGCGGACGATCCGGTGCACCGGCGGCTGCGCGGCCTGGTCAGCCGCGCGTTC
ACCCCGAAGATGATCGCCGGACTTGAACCCCGGATCACCGAGGTGACCTTGCAGCTGCTC
GACGACGCGGACGCCGGCGGCGACCAGTGGGACCTGATCGAGCAGCTGGGCTACCCGCTG
CCGTTCATCGTCATCGCCGAGATGCTCGGCATCCCGGTCAGCGACCGCGCGTTCGTCCGG
CGGCTGTCCGACACCTTCTTCGAGGTGCACAACGTCGATCCGGAACAGTCGCTGGATTCC
CTCGGGGAGAGCGCGGTGAACAATGTCGCGCCGCTGCTGCGCGAGTTGAACACCCACCTG
CTGGAGTTCGTCCGCCGCCGCCGCAAGAACCCGGGCGACGACCTCACCAGCAAGCTTCTG
GAGGTCGAGGTCGACGGTGTGCGGCTGGACGACGAGGAGACCGTCGGCTTCCTCGGCCTG
CTNCTGCTCGCCGGCCACGTCACCGCGACCTCCACCCTGGGCAACACGGTTCTCGCGTTG
CACGAGAACCCCGAGGTGTGGACGCAGCTGCGGGCCGATCCCGCGCTGATTCCGGCCGCG
GTCGAGGAGTCGATGCGCTACCGGCCTCCGTTCCCCCGTCTCGGGCGGCAGGCGACGAAG
GACGTCGAGATCGGCGGGCAGAAGATCCCGGCCGGCGCCTTCGTCCTGGCGTGGCTGACC
ACCGCGAACCGCGATGACCGCGTCTTCGCCGACCCGGACCGGTTCGACATCCACCGGGCC
CCCAACCCGCACCTGACGTTCGGCAAGGGCATGCACTTCTGCCTTCGGGGCGCCCTGGCG
CGGCTCGAGGTGGGGATCGCCCTGCGCCTTCTGATGGAGCGGTACAGCGACATCCGCGTA
CGCGACGACCTACCGGTCAACCTGCGCAACCCCTGGGCGATGATCGGCGTCAACCAGCTG
CCCATCGAGGTCCGCAAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [34-426]  4.6e-103 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [63-422]  1.9e-31 PF00067
PF00067   p450
 [34-426]  6.7e-94 SSF48264
SSF48264   Cytochrome P450
IPR002397 Cytochrome P450, B-class (Family)
 [104-115]  3.3e-51 PR00359 [151-167]  3.3e-51 PR00359 [168-183]  3.3e-51 PR00359 [218-240]  3.3e-51 PR00359 [299-310]  3.3e-51 PR00359 [316-343]  3.3e-51 PR00359 [344-359]  3.3e-51 PR00359 [365-374]  3.3e-51 PR00359 [374-385]  3.3e-51 PR00359
PR00359   BP450
SignalP
 [1-18]  0.265 Signal
Eukaryota   
TMHMM No significant hit