close all open/close all

CDS information : Rubra_00080


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction23,695 / 24,459 / + [in whole cluster]
23,695 / 24,459 / + [in contig]
Location23695..24459 [in whole cluster]
23695..24459 [in contig]
TypeCDS
Length765 bp (254 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acetyltransferase
Product (GenBank)putative 30S ribosomal protein modification
Gene
Gene (GenBank)rubR2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [putative 30S ribosomal protein modification]
MFVRLPGCSPYWSRQATDVDVAGAHQRHSWKATAINLKHPTPDPVITRVAEDQWHASDGD
LVVGSGDTGRRPDGRLYISIDAWHDTAFDRLAAAMLAELPAPLYTLVDADDADTISNWRR
AGFTPHRSERQYLLVPGEAQPAVSPPAGVTLTGGAEESRAEVEGVEVGVIRISPSMRDNG
RPRIARIRSIEVRADQRRRGIGRALLVHALDALHTREFGLATIDVDETDTATISLLESVG
ARRESNTLELTWQK
selected fasta
>putative acetyltransferase [putative 30S ribosomal protein modification]
ATGTTCGTTCGATTACCCGGGTGCTCCCCCTATTGGTCACGGCAGGCGACTGATGTAGAT
GTCGCGGGAGCGCACCAGAGGCACTCCTGGAAGGCGACAGCCATCAACCTTAAGCATCCC
ACCCCAGACCCCGTGATCACGCGGGTCGCCGAAGACCAGTGGCACGCCAGCGACGGCGAC
TTGGTTGTCGGCAGTGGCGACACGGGGCGCAGGCCCGACGGGCGACTGTACATCAGCATC
GACGCATGGCACGACACAGCCTTCGACCGGCTGGCCGCCGCCATGCTGGCGGAACTGCCG
GCGCCGCTCTACACGCTGGTCGACGCCGACGACGCGGACACGATCTCGAACTGGCGGCGG
GCCGGCTTCACCCCTCACCGAAGTGAGCGGCAGTACCTGCTGGTGCCCGGCGAAGCGCAG
CCCGCCGTGTCGCCCCCGGCGGGGGTGACGTTGACCGGCGGCGCGGAGGAGTCCCGCGCC
GAAGTCGAGGGGGTCGAAGTCGGTGTGATCCGGATTTCGCCGTCGATGCGGGACAACGGG
AGGCCGCGGATCGCGCGGATTCGCTCCATCGAGGTCCGCGCCGACCAGCGCCGCCGTGGC
ATCGGCAGGGCGCTGCTGGTCCACGCGCTGGACGCTCTGCACACTCGCGAGTTCGGTCTC
GCGACGATCGACGTCGACGAGACCGACACCGCGACGATCAGCCTGTTGGAAAGCGTCGGA
GCCCGCCGTGAGAGCAACACCTTGGAGCTGACGTGGCAAAAGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [160-241]  8.10000000000001e-10 PF00583
PF00583   Acetyltransf_1
 [102-254]  PS51186
PS51186   GNAT
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [107-244]  1.8e-12 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [90-249]  6.69999687625999e-14 SSF55729
SSF55729   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit