close all open/close all

CDS information : Rubra_00100


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction24,859 / 25,854 / + [in whole cluster]
24,859 / 25,854 / + [in contig]
Location24859..25854 [in whole cluster]
24859..25854 [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative amidase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q5I9D2
PmId
[16332774] L-selective amidase with extremely broad substrate specificity from Ochrobactrum anthropi NCIMB 40321. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative amidase [hypothetical protein]
MHTVQSTLATVRPGVLDPGAASAARIESGDQVLYPDTWTNWQNQLRYGSSPADRARLRQE
YPGCPFQIVGPVEVTGAEPGDVVECRLTELRLSDWGGNAFPTRAGALPYDFDEPYFHDFR
FDRTRTRADYVHGISLPLDPFAGIIAVEPPGDEQTSALIGGDHGGNLALPELTVGSSLFL
PVAKPGARIWIGDIHALQGDGLVDQTGLKSTAERLRMRYDLHKNVGLTRPLAETDTHWIG
IGLADSLEAALVDCLRGLISWFSAASGVTRAEAHALCSMAASFRITQYADQSEVHHVDVP
LPPKGVHGLLRKDIFPAGLRTRVDRWLRPAA
selected fasta
>putative amidase [hypothetical protein]
ATGCATACGGTTCAGTCCACATTGGCCACGGTCCGGCCGGGCGTCCTCGATCCCGGCGCT
GCGTCGGCAGCCAGGATCGAGTCCGGCGACCAGGTTCTCTACCCCGACACCTGGACCAAC
TGGCAGAACCAGCTGCGGTACGGCTCGTCCCCGGCCGACCGTGCGCGGCTGCGCCAGGAG
TACCCGGGCTGCCCGTTCCAGATCGTCGGCCCGGTCGAGGTGACCGGTGCCGAACCGGGC
GACGTCGTCGAGTGCCGGCTGACGGAACTGCGGCTGAGCGACTGGGGCGGCAACGCCTTC
CCCACCCGGGCCGGCGCGCTGCCGTACGACTTCGACGAGCCGTACTTCCACGACTTCCGG
TTCGACCGGACCCGCACCCGGGCCGACTACGTTCACGGCATCTCGCTGCCGCTCGACCCG
TTCGCCGGCATCATCGCGGTCGAACCGCCGGGCGACGAGCAGACAAGCGCGCTGATCGGT
GGCGACCACGGCGGCAACCTGGCCCTCCCCGAACTCACCGTGGGCTCCTCGCTGTTCCTT
CCCGTGGCCAAGCCGGGGGCCCGGATCTGGATCGGTGACATTCACGCCCTGCAGGGCGAC
GGACTGGTCGACCAGACCGGCCTGAAGTCCACGGCCGAGCGCTTGCGGATGCGGTACGAC
CTCCACAAGAACGTGGGCCTGACCCGGCCGCTGGCCGAGACCGACACGCACTGGATCGGC
ATCGGACTGGCTGACAGCCTGGAGGCCGCACTGGTCGACTGCCTGCGCGGACTGATCAGC
TGGTTCAGCGCGGCGTCCGGCGTCACCCGCGCCGAGGCCCACGCACTGTGCAGCATGGCC
GCGAGCTTCCGGATCACCCAGTACGCGGACCAGAGCGAGGTCCACCACGTCGATGTCCCC
CTGCCGCCCAAGGGCGTGCACGGCCTCCTGCGCAAAGACATCTTCCCGGCCGGCCTGCGT
ACCCGGGTCGACCGCTGGCTGCGCCCCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004304 Acetamidase/Formamidase (Family)
 [67-152]  0.00014 PF03069 [158-231]  1.4e-10 PF03069
PF03069   FmdA_AmdA
SignalP
 [1-23]  0.399 Signal
Bacteria, Gram-negative   
 [1-23]  0.54 Signal
Bacteria, Gram-positive   
 [1-23]  0.178 Signal
Eukaryota   
TMHMM No significant hit