close all open/close all

CDS information : Rubra_00110


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction26,018 / 27,583 / + [in whole cluster]
26,018 / 27,583 / + [in contig]
Location26018..27583 [in whole cluster]
26018..27583 [in contig]
TypeCDS
Length1,566 bp (521 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productaminocoumarin--carboxylic acid ligase
amide synthetase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number6.3.1.-
Keyword
Note
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[21448870] Adenylate-forming enzymes of rubradirin biosynthesis: RubC1 is a bifunctional enzyme with aminocoumarin acyl ligase and tyrosine-activating domains. (Chembiochem. , 2011)
Related Reference
ACC
Q9L9F6
PmId
[10801869] Cloning, overexpression, and purification of novobiocic acid synthetase from Streptomyces spheroides NCIMB 11891. (J Biol Chem. , 2000)
ACC
Q2PC59
NITE
Rubra_00310
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[21448870] Adenylate-forming enzymes of rubradirin biosynthesis: RubC1 is a bifunctional enzyme with aminocoumarin acyl ligase and tyrosine-activating domains. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>aminocoumarin--carboxylic acid ligase [hypothetical protein]
MSTTHVHYVQQLLTHFDADPDRPAMVSGDVPFSAGELADAVRRAAAAMGRHGVGRGDVVC
ILTEPNTAATLILRWAANLVGATAAHVRGMNAVVPDDELRMDLQRAIVSDVGARMLAVDP
ANEARARELLVNATGRPVLAVLGAGQPDTVDLTAGCGDGVGPCPDITDSDLAVITQTSGA
SGLPKGVCWPFGVKNDMAASAIDRSSRTNVLITAPLTHSSGFAADDTLITGGMVVLHPGF
DAAAVLHAIAQHRIGRLILGTPQVYALAEHPDRAATDLSSLTELIYTGSPGAPLKLRKAR
EIFGPVLIQVYGTTEDRSAHMLPRRHEHLRACSSAGRPVNPEALSIRHPDTGAVLPVGEV
GEVCAVPRWPTAGYWHEPALTAALVRDGWVRTGDLGHLDTDGYLHLTGRLANMMKVKGIR
IHPEQVEKVLRQAPGVSQAAVCGVEDADRVEHIYAAVVPEPGADPDPRELRRHVAEALSD
TYVPRLIDIRRKLPTTGWDKPDRVRLRADARAALTRPAPQA
selected fasta
>aminocoumarin--carboxylic acid ligase [hypothetical protein]
ATGAGTACCACGCATGTGCATTATGTTCAGCAGCTGCTGACTCATTTCGATGCCGATCCG
GATCGCCCTGCCATGGTCAGCGGGGACGTCCCCTTCTCCGCCGGGGAGCTGGCCGACGCC
GTTCGCCGGGCCGCGGCCGCGATGGGCCGCCACGGCGTCGGCCGCGGTGACGTCGTCTGC
ATCCTGACCGAGCCCAACACCGCGGCCACACTGATCCTGCGGTGGGCGGCCAACCTGGTG
GGGGCGACCGCCGCACATGTGCGTGGGATGAATGCGGTGGTGCCTGACGACGAGTTGCGC
ATGGACTTGCAGCGCGCCATCGTCTCGGATGTCGGCGCCCGGATGCTGGCGGTCGACCCG
GCCAACGAGGCACGGGCACGGGAGCTGCTGGTGAACGCGACCGGTCGGCCGGTCCTGGCC
GTACTGGGCGCAGGACAGCCGGACACGGTGGATTTGACCGCCGGCTGCGGTGACGGAGTA
GGCCCGTGCCCGGACATCACCGACAGCGACCTCGCGGTGATCACCCAGACCAGTGGGGCG
AGCGGCCTGCCGAAGGGTGTCTGCTGGCCCTTCGGCGTCAAGAACGACATGGCCGCATCG
GCCATCGACCGCAGCAGCCGGACGAACGTCCTGATCACCGCACCGCTCACCCATTCCAGC
GGGTTCGCCGCGGACGACACGCTCATCACCGGCGGCATGGTCGTCCTGCATCCCGGCTTC
GACGCCGCGGCCGTGCTCCACGCGATCGCGCAGCACCGCATCGGCCGGCTCATCCTCGGC
ACCCCGCAGGTGTACGCACTGGCCGAGCACCCGGACCGGGCGGCCACCGACCTGTCCAGC
CTGACCGAGCTGATCTACACCGGCAGCCCCGGGGCACCGCTCAAGCTGCGCAAGGCCCGG
GAAATCTTCGGCCCCGTACTGATCCAGGTCTACGGCACGACCGAAGACCGGAGTGCTCAC
ATGCTCCCCCGGCGACACGAACACCTGCGCGCCTGCTCCAGCGCGGGCCGGCCGGTCAAC
CCAGAGGCGCTCAGCATCCGGCACCCCGACACCGGCGCGGTACTGCCCGTCGGCGAGGTC
GGCGAGGTCTGCGCGGTTCCACGCTGGCCCACGGCCGGCTACTGGCACGAGCCGGCACTC
ACCGCGGCACTCGTCCGCGACGGCTGGGTGCGCACCGGCGACCTCGGGCACCTCGACACC
GACGGCTACCTGCACCTGACCGGCCGGCTCGCGAACATGATGAAGGTCAAGGGAATCCGC
ATCCACCCCGAGCAGGTGGAGAAGGTGCTCAGGCAGGCCCCGGGCGTGTCCCAGGCCGCC
GTATGCGGGGTCGAGGACGCCGACCGGGTGGAGCACATCTACGCCGCCGTCGTGCCCGAG
CCCGGCGCCGACCCGGATCCCCGGGAACTGCGCCGTCACGTCGCCGAGGCACTGTCCGAC
ACCTACGTCCCCCGCCTGATCGACATTCGCCGGAAACTGCCGACGACCGGCTGGGACAAA
CCCGATCGGGTCCGGCTGCGGGCCGACGCCCGCGCCGCACTGACCCGGCCCGCCCCCCAG
GCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [35-441]  7.00000000000005e-59 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit