close all open/close all

CDS information : Rubra_00120


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction27,957 / 28,952 / + [in whole cluster]
27,957 / 28,952 / + [in contig]
Location27957..28952 [in whole cluster]
27957..28952 [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q7X2F7
NITE
Gilvo_00070
PmId
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>putative methyltransferase [hypothetical protein]
MDGFELHDLARKLLRIGEDALPDPTGVRQLSPGVRHVMTDVFEHPDTSVTEIANRTGFPA
SHVETSVATLRDRGAVTTAAAPDGQTVVRAAARHRSAGRAAARIDEQLAAAAGIQDPGQA
KELVETLEQLARRLTDALSPEHFNARYAGTPPWETGRPQPALRDLAEAGAFRGRVLDVGC
GTGEVALMAAALGLPTVGIDPASTAIEIARRKAEERGLQARFLVGDALELGAMGEQFDTV
LDCGLFHVFSDAERVRYADSLATVMPPDARLFLLCFSDRHPPDIGPRRVSQDEIRATFAD
GWRVDSIEPAMLENNKYVDGVLAWLASITRT
selected fasta
>putative methyltransferase [hypothetical protein]
ATGGACGGCTTCGAACTGCACGACCTCGCGCGCAAGCTGCTGCGGATCGGCGAGGACGCC
CTCCCGGACCCCACCGGTGTGCGACAGCTGTCTCCCGGCGTGCGTCACGTCATGACCGAC
GTGTTCGAACACCCGGACACCTCGGTCACCGAGATCGCCAACCGCACCGGCTTCCCGGCG
AGCCACGTGGAGACGAGCGTCGCCACCCTGCGCGACCGGGGTGCGGTCACCACCGCGGCC
GCCCCGGACGGACAAACGGTCGTCCGGGCGGCTGCCCGGCACAGGAGCGCCGGCCGAGCC
GCCGCGCGGATCGACGAGCAGCTCGCCGCGGCCGCCGGGATCCAAGACCCCGGCCAGGCC
AAGGAATTGGTCGAGACACTCGAGCAACTGGCGCGCCGGCTCACCGATGCCCTGTCCCCC
GAGCATTTCAACGCGCGGTATGCGGGTACGCCGCCCTGGGAAACCGGCCGTCCGCAACCG
GCCCTGCGCGACCTCGCCGAGGCGGGCGCCTTCCGCGGCCGGGTGCTCGACGTCGGGTGC
GGCACCGGCGAGGTCGCGCTCATGGCGGCGGCCCTCGGCCTGCCGACGGTCGGCATCGAC
CCGGCGTCGACGGCGATCGAGATCGCGCGGCGCAAAGCGGAAGAGCGCGGCCTGCAGGCG
CGCTTCCTGGTCGGGGACGCACTCGAACTCGGCGCCATGGGCGAGCAGTTCGACACCGTG
CTCGACTGCGGCCTGTTCCACGTGTTCAGCGACGCCGAACGAGTCCGCTACGCCGACAGC
CTGGCCACCGTGATGCCGCCGGACGCGCGGTTGTTCCTGCTCTGCTTCAGCGACCGCCAT
CCACCCGATATCGGACCGCGGCGGGTGAGCCAGGACGAAATCCGGGCCACCTTCGCCGAC
GGCTGGCGGGTCGATTCGATCGAACCCGCGATGCTGGAGAACAACAAATATGTCGACGGA
GTGCTGGCCTGGCTGGCCAGTATCACCCGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [4-135]  1e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit