close all open/close all

CDS information : Rubra_00140


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction29,902 / 31,062 / + [in whole cluster]
29,902 / 31,062 / + [in contig]
Location29902..31062 [in whole cluster]
29902..31062 [in contig]
TypeCDS
Length1,161 bp (386 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase
putative AHBA synthase/UDP-3-keto-D-glucose aminotransferase
Product (GenBank)putative AHBA synthase
Gene
Gene (GenBank)rubK
EC number4.2.1.144
2.6.1.-
Keyword
  • AHBA
Note
  • bifunctional protein
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52552
NITE
Rifam_00310
PmId
[9497318] 3-Amino-5-hydroxybenzoic acid synthase, the terminal enzyme in the formation of the precursor of mC7N units in rifamycin and related antibiotics. (J Biol Chem. , 1998)
[10433690] Crystal structure of 3-amino-5-hydroxybenzoic acid (AHBA) synthase. (Biochemistry. , 1999)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)

close this sectionSequence

selected fasta
>putative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [putative AHBA synthase]
MSPRPRPTFPDWPQFDDTERRALDRALSQGQWWRMGGSEVDSFEREFAGYHGAHHALAVT
NGTHALELALQVLGAGPGTEVIVPAFTFISSSQAAQRIGAVAVPVDVDPETYNIDATATA
EAITPRTRVIMPVHMAGLMADMDALDKLASDAGVRILQDAAHAHGARWRGKRVGELGSIA
AFSFQNGKLMTAGEGGAVLFLDPDDYEKAFLHHSCGRPRTDRNYHHQVAGTNMRMNEFSA
AVLRAQLGRLDGQIELREQRWRLLSQLLAQIPGVRPQGGDARADRNPHYMAMFRLPGWSE
ERRNLLVDRLVDAGIPAFAGFRAIYRTAAFWETGAPEESVDAVAKRCPNADAISQDCVWL
HHRTLLASEQALTDTAAIVADQVAAG
selected fasta
>putative 3-amino-5-hydroxybenzoic acid synthase/UDP-3-keto-D-glucose aminotransferase [putative AHBA synthase]
ATGAGTCCGCGACCGAGGCCGACCTTTCCGGATTGGCCGCAATTCGATGACACCGAACGC
CGAGCTCTTGATCGTGCGCTGTCCCAGGGCCAGTGGTGGCGCATGGGTGGCAGCGAGGTG
GACAGCTTCGAGCGGGAGTTCGCCGGATACCACGGTGCCCACCACGCCCTCGCCGTCACC
AACGGCACGCACGCGCTGGAGCTCGCCCTGCAGGTGCTGGGTGCGGGACCGGGCACCGAA
GTGATCGTGCCGGCGTTCACCTTCATCTCCTCGTCCCAGGCCGCTCAGCGGATCGGGGCC
GTCGCCGTGCCGGTGGACGTCGATCCGGAGACCTACAACATCGACGCGACCGCCACCGCC
GAGGCGATCACACCGCGGACCCGGGTGATCATGCCGGTGCACATGGCGGGTCTCATGGCC
GACATGGACGCACTGGACAAGCTCGCCTCCGATGCCGGCGTCCGGATCCTTCAGGACGCG
GCCCACGCGCACGGTGCCCGGTGGCGGGGCAAGCGCGTGGGCGAGCTGGGCTCGATCGCG
GCGTTCAGCTTCCAGAACGGCAAGCTGATGACCGCGGGCGAGGGCGGCGCGGTGCTGTTC
TTGGACCCGGACGACTACGAGAAGGCATTCCTGCATCACTCCTGCGGCCGGCCGCGCACC
GACCGCAACTATCACCACCAGGTGGCCGGCACCAACATGCGGATGAACGAGTTCTCGGCC
GCCGTCCTGCGCGCTCAGCTGGGCCGCCTCGACGGCCAGATCGAGCTGCGCGAGCAGCGG
TGGCGGTTGCTGTCGCAGCTCTTGGCCCAGATCCCCGGCGTCCGGCCGCAGGGCGGTGAT
GCGCGGGCCGACCGGAATCCGCACTACATGGCGATGTTCCGGCTTCCCGGCTGGTCGGAG
GAGCGTCGCAACCTCCTCGTCGATCGCCTGGTCGACGCGGGGATCCCGGCGTTCGCGGGC
TTCCGCGCCATCTACCGCACCGCGGCGTTCTGGGAGACCGGCGCACCCGAGGAGTCCGTC
GACGCGGTCGCCAAGCGGTGCCCCAACGCCGACGCGATCAGCCAGGACTGCGTCTGGCTG
CACCACCGCACCCTGCTCGCGTCGGAGCAGGCTCTCACCGACACCGCCGCCATCGTGGCC
GACCAGGTGGCCGCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-386]  2.19999900980707e-127 PIRSF000390
PIRSF000390   PLP_StrS
 [15-371]  1.29999999999998e-116 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [11-248]  3.79999999999991e-76 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [249-384]  9.50000000000005e-61 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [5-386]  4.50001022902825e-102 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit