close all open/close all

CDS information : Rubra_00150


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction31,059 / 32,153 / + [in whole cluster]
31,059 / 32,153 / + [in contig]
Location31059..32153 [in whole cluster]
31059..32153 [in contig]
TypeCDS
Length1,095 bp (364 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative UDP-glucose C-3 dehydrogenase
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)rubL
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q7BUE1
NITE
Rifam_00320
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207504] Kanosamine biosynthesis: a likely source of the aminoshikimate pathway's nitrogen atom. (J Am Chem Soc. , 2002)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)

close this sectionSequence

selected fasta
>putative UDP-glucose C-3 dehydrogenase [putative oxidoreductase]
MRIRTVLVGFGWSGREIWLPRLMANGDYEVVAAVDPDPARREAFTAATGRPAFGDVDALR
AEDADLALVASPNHLHAALARRLLTRGLATFVEKPVCLSSAEADRLAAAERAGGVPLLAG
SACRYRADVRALAGLAGELGHLRHIDLVWERACGVPRSQGWFTSRAEAGGGVLFDLGWHL
LDVLETVAGPLAFVQAAASTSYDHVNDPRWTAAWRHDQPVPELDADVEDTVRGFLVTGSG
LSVGLRASWATHAASHDVTEIRIEGSDDTAMLRSTFGFSPNREPRPRLSVVRRGRTSEIT
VPTEPIGAEYSRQLDDIRDHLADPSACGSAIAGVRRIVGTIEALYAASATPLLPAGPVMT
AAAT
selected fasta
>putative UDP-glucose C-3 dehydrogenase [putative oxidoreductase]
ATGAGGATCCGCACCGTACTGGTCGGGTTCGGGTGGTCCGGCCGAGAGATCTGGCTTCCT
CGTCTGATGGCAAACGGTGACTACGAGGTAGTGGCCGCGGTCGATCCGGATCCGGCCAGG
CGGGAGGCGTTCACCGCGGCGACCGGCCGTCCGGCCTTCGGCGACGTCGACGCGCTGCGG
GCCGAGGACGCCGACCTCGCGTTGGTCGCCTCGCCCAACCACCTGCACGCGGCGCTCGCG
CGACGTCTTCTCACCCGAGGTCTCGCCACCTTCGTGGAGAAGCCGGTCTGCCTCTCGAGC
GCGGAGGCGGACAGGCTGGCCGCGGCCGAGCGGGCAGGCGGCGTCCCGTTGCTGGCCGGA
AGTGCGTGCCGATACCGCGCGGACGTGCGGGCACTGGCCGGTCTGGCCGGCGAGCTCGGC
CACCTGCGCCACATCGACCTGGTGTGGGAACGGGCCTGCGGAGTGCCCCGGTCCCAGGGC
TGGTTCACCAGCCGGGCGGAGGCAGGCGGCGGGGTGCTGTTCGACCTCGGATGGCATCTG
CTCGATGTCCTGGAGACCGTCGCCGGGCCGTTGGCGTTCGTTCAGGCCGCCGCGTCCACC
TCGTACGACCACGTCAACGACCCGCGCTGGACGGCGGCCTGGCGGCATGATCAGCCGGTG
CCGGAACTCGACGCGGACGTCGAGGACACCGTGCGCGGCTTCCTGGTCACCGGCAGCGGT
CTGTCGGTGGGCCTTCGCGCCAGCTGGGCCACGCACGCGGCGAGCCATGACGTCACCGAG
ATCCGGATCGAGGGGAGTGACGACACCGCGATGCTCCGGTCCACCTTCGGCTTCAGCCCC
AATCGCGAGCCGCGGCCGCGGCTCAGCGTCGTCCGGCGGGGCCGGACGAGCGAGATCACG
GTCCCGACCGAGCCGATCGGCGCCGAGTACTCCCGTCAGCTCGACGACATCAGGGACCAC
CTCGCCGATCCGTCGGCGTGCGGATCCGCGATCGCGGGCGTGCGGCGGATCGTCGGCACG
ATCGAGGCGCTGTACGCGGCCTCGGCGACACCGCTGCTGCCCGCCGGGCCGGTCATGACC
GCGGCGGCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [3-115]  3.39999999999999e-23 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [136-202]  4.80000000000001e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [2-137]  1.3e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit