close all open/close all

CDS information : Rubra_00160


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction32,153 / 32,818 / + [in whole cluster]
32,153 / 32,818 / + [in contig]
Location32153..32818 [in whole cluster]
32153..32818 [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative hydrolase
Product (GenBank)putative phosphatase
Gene
Gene (GenBank)rubM
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52553
NITE
Rifam_00330
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
Family/Domain
FD
IPR006439

close this sectionSequence

selected fasta
>putative hydrolase [putative phosphatase]
MASVPVRSVVIFDLDGVLVDSHEVMGRAFAAAYAEVVGAGPAPFAEYQRHQGLYFPDIMR
RMRLPLEMEEPFVRESYRLADQVPVADGVADLLQTLRTRGFRLAVATGKAGPRARSLLAT
LGLIQYFDHVVGSDEVANAKPAPDIVRRALSLLDAEPDAALMVGDAPADIRSARSAGVTA
VAATWATVDEDGLMAAGPDLVVHSPGELLPACPPVPAPGRR
selected fasta
>putative hydrolase [putative phosphatase]
ATGGCGAGCGTACCGGTGCGCAGTGTGGTGATCTTCGACCTCGACGGCGTCCTGGTGGAC
AGTCATGAGGTGATGGGCCGGGCCTTCGCCGCGGCGTACGCGGAAGTGGTCGGCGCCGGA
CCGGCGCCGTTCGCCGAATACCAGCGCCATCAGGGCCTGTATTTCCCGGATATCATGCGC
CGGATGCGCCTCCCGCTGGAGATGGAGGAGCCGTTCGTCCGGGAGAGCTACCGGCTCGCG
GACCAGGTGCCCGTGGCGGACGGGGTGGCCGATCTGCTCCAGACGCTCCGGACGCGTGGG
TTCCGGCTCGCCGTGGCCACCGGGAAGGCAGGGCCGCGGGCTCGCTCCCTGCTGGCCACG
CTCGGCCTGATCCAGTACTTCGACCACGTAGTGGGCTCGGACGAGGTCGCCAACGCCAAA
CCCGCCCCGGACATCGTCAGGCGCGCGCTCAGCCTGCTCGACGCGGAGCCGGACGCGGCC
CTCATGGTCGGCGATGCCCCGGCCGACATCCGCAGCGCCCGAAGCGCCGGGGTGACCGCC
GTAGCGGCGACCTGGGCGACCGTGGACGAGGACGGCCTGATGGCTGCCGGTCCGGATCTG
GTCGTCCACTCCCCCGGTGAACTGCTGCCGGCGTGCCCGCCGGTCCCGGCTCCGGGCCGG
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [7-18]  2.49999811956465e-09 PR00413 [96-109]  2.49999811956465e-09 PR00413 [127-143]  2.49999811956465e-09 PR00413 [145-165]  2.49999811956465e-09 PR00413
PR00413   HADHALOGNASE
IPR006351 3-amino-5-hydroxybenzoic acid synthesis-related (Family)
 [10-212]  1.99999999999999e-96 TIGR01454
TIGR01454   AHBA_synth_RP
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [9-181]  1.1e-14 TIGR01509
TIGR01509   HAD-SF-IA-v3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [87-177]  6.80000000000001e-11 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [7-211]  8.20001307135067e-50 SSF56784
SSF56784   HAD-like_dom
 [9-21]  7.5e-42 G3DSA:3.40.50.1000 [82-210]  7.5e-42 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
SignalP
 [1-30]  0.118 Signal
Bacteria, Gram-positive   
TMHMM No significant hit