close all open/close all

CDS information : Rubra_00170


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction32,815 / 33,738 / + [in whole cluster]
32,815 / 33,738 / + [in contig]
Location32815..33738 [in whole cluster]
32815..33738 [in contig]
TypeCDS
Length924 bp (307 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative kanosamine kinase
Product (GenBank)putative kinase
Gene
Gene (GenBank)rubN
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52554
NITE
Rifam_00340
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>putative kanosamine kinase [putative kinase]
MTGRTAWPGSWLGIDFGGTKVALRAETDGGEVSEHTFRWRGRGLESDLSQLATELARFRR
RIPQGYTGIGVAMPANGGGGRAGHDLARTAPEWTGLDLRRTFRSHFGDTPVRWADDGYAG
PLGKRGRWAATKLLYVGVGTGVGGGLLAGGTLWPGPDRGSFELGHVVTDVDGPICSCGRR
GCLQATASGPATLARAAGMRGVPVGYDDLRQGLVADEEWAVQAVDRTCHRLAVAISGVRE
LLHPGTVVVGGGFAAGLPVFAGLVAHHLAALARPGVPAPVVRASVLGPLSTLHGAVALAR
LPGPDPL
selected fasta
>putative kanosamine kinase [putative kinase]
GTGACGGGGCGGACGGCATGGCCGGGAAGCTGGCTCGGCATCGATTTCGGTGGCACCAAG
GTGGCGCTGCGGGCGGAGACCGACGGCGGAGAAGTCAGCGAGCACACCTTCCGATGGCGC
GGGCGCGGGCTGGAGTCCGACCTGAGCCAGCTCGCGACCGAACTCGCCCGGTTCCGGCGG
CGAATCCCGCAGGGCTACACCGGAATCGGAGTCGCGATGCCGGCCAACGGTGGGGGCGGA
CGGGCTGGTCACGACCTGGCCCGAACCGCCCCCGAGTGGACCGGCCTTGATCTGCGGCGG
ACGTTCCGCTCGCACTTCGGGGACACCCCGGTCCGCTGGGCCGACGACGGGTATGCTGGG
CCCCTGGGCAAGCGCGGGCGCTGGGCTGCGACGAAGCTGCTCTATGTAGGGGTGGGAACG
GGCGTGGGCGGTGGGCTGCTCGCGGGCGGCACGCTGTGGCCCGGACCGGATCGCGGTTCC
TTCGAGCTCGGTCACGTGGTGACCGACGTGGACGGCCCGATCTGCTCGTGCGGGCGCCGC
GGGTGCCTTCAGGCCACCGCGTCCGGACCCGCGACGTTGGCGCGAGCGGCCGGGATGCGG
GGGGTGCCGGTCGGGTACGACGACCTCCGCCAGGGCCTGGTGGCGGACGAGGAGTGGGCG
GTCCAGGCCGTGGACCGCACCTGCCACCGGCTCGCGGTGGCCATCAGCGGGGTGCGAGAA
CTCCTGCACCCCGGCACGGTCGTGGTGGGGGGCGGCTTCGCCGCCGGACTGCCCGTGTTC
GCCGGCCTGGTCGCGCACCATCTGGCCGCGCTGGCCCGGCCGGGCGTGCCGGCACCGGTG
GTGCGGGCGTCTGTGCTGGGCCCGCTGTCCACGCTGCACGGCGCGGTCGCGCTGGCCCGC
CTGCCCGGACCGGATCCGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [13-191]  3.8e-17 PF00480
PF00480   ROK
SignalP No significant hit
TMHMM
 [133-155]  Transmembrane (i-o) [241-263]  Transmembrane (o-i)
Transmembrane 2