close all open/close all

CDS information : Rubra_00180


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction34,709 / 33,777 / - [in whole cluster]
34,709 / 33,777 / - [in contig]
Locationcomplement(33777..34709) [in whole cluster]
complement(33777..34709) [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productglycosyltransferase family protein
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)rubG1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR004276

close this sectionSequence

selected fasta
>glycosyltransferase family protein [putative glycosyltransferase]
MRFLFTTFAWSSHYYPMVPLGWALQAAGHEVRVATTPSLVDAVVTTGLPAVAVGKDIDIV
GRAGSGKLHDHERWPTDRDKVSCAEDRPSAWIDPCPPSMRVPGQTTAPRLPVRYVPYNAP
GALPAWLIEPPTRPRVCITWGISTVRMIGDAVTGPLSRVVEAVSALGVDVVLAVSAATRA
ALGTVPDGVRVAESLPLHLLLPSCRAIVHQGGVGTALTAGVYAVPQLTVTQFSDQMAVGD
VLAAGGAGRHLLHDEATVERITSHVLGLLDDQECLQAAKLLQREIVSQPAPAALVPRLVQ
LAGLRASPRA
selected fasta
>glycosyltransferase family protein [putative glycosyltransferase]
ATGAGATTCCTGTTCACCACGTTCGCGTGGTCGTCGCACTACTACCCGATGGTGCCGCTC
GGGTGGGCGTTGCAGGCCGCTGGGCATGAGGTACGAGTAGCGACCACGCCGTCGCTGGTC
GACGCGGTCGTCACGACGGGACTGCCGGCGGTGGCGGTGGGCAAGGACATCGACATCGTG
GGCAGGGCCGGGTCCGGCAAGCTGCACGATCATGAACGGTGGCCGACCGATCGAGACAAG
GTGAGTTGCGCCGAGGACCGCCCGTCGGCGTGGATCGACCCCTGCCCGCCCAGCATGCGC
GTCCCCGGACAGACCACGGCCCCGCGGCTGCCCGTCCGGTATGTGCCTTACAACGCCCCC
GGTGCGCTGCCGGCATGGCTCATCGAGCCGCCGACTCGGCCTCGCGTGTGCATCACCTGG
GGCATCTCGACAGTGCGGATGATCGGTGACGCGGTGACCGGTCCGCTGAGCCGGGTCGTC
GAGGCGGTCTCCGCCCTCGGTGTGGATGTCGTGCTCGCCGTCTCCGCAGCCACTCGAGCG
GCTCTTGGCACGGTGCCGGACGGAGTGCGGGTGGCGGAGTCGCTGCCCCTGCACCTGCTG
CTGCCGAGCTGCCGGGCCATCGTGCACCAAGGCGGGGTGGGCACCGCGCTCACCGCAGGC
GTCTACGCGGTGCCCCAACTGACGGTCACCCAGTTCTCCGACCAGATGGCGGTCGGCGAC
GTACTCGCGGCCGGCGGTGCCGGCCGGCATCTCCTCCACGACGAGGCCACCGTGGAGCGG
ATCACGTCCCACGTCCTCGGGCTGCTGGACGACCAGGAGTGCCTCCAAGCCGCCAAGCTC
CTGCAACGGGAGATCGTCTCGCAGCCCGCGCCGGCCGCCTTGGTGCCGAGACTGGTGCAG
CTGGCGGGCCTGCGTGCGTCACCCCGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-64]  2.1e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [92-190]  9.8e-30 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.7 Signal
Eukaryota   
 [1-14]  0.472 Signal
Bacteria, Gram-negative   
TMHMM No significant hit