close all open/close all

CDS information : Rubra_00190


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction38,087 / 34,797 / - [in whole cluster]
38,087 / 34,797 / - [in contig]
Locationcomplement(34797..38087) [in whole cluster]
complement(34797..38087) [in contig]
TypeCDS
Length3,291 bp (1,096 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)Rub7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MGTKMPDVNDLVDVATGDATVAETDVTLPGVLPLVLERVHRSSTRTGRWFGRSWTSSLDQ
RLHVTGGQIHARFAGGQTLTFTSPGSAGDPPAVPVTGPAWPLRQNPDGSYAISDPQRGLT
WRFERRPGYEDDELPLVSLTDRTGHEITFSYDAVGRPLSITHSGGYRVLVTVTDERITAL
ALAGRGGQDDIPLRRFEYDDSGNLSGVVNSSGLPRRFTYDDMGRLTGWTDRNGYSYHYTF
DSEGRCVRGEGPDGVLSGTFVYEPGVTRWTTTDGDVTTYAINESAHVVAVTDPIGKTTRT
QYDERGRVTVRTDPLDRVTRHAYDERGNLVSVTDPAGHEYHVYVNDACLPERITAPDGTV
WLQDFDKNGNLTEQTAPDGSVLTYAYDSRGHLSRMTGADGAVTTIACDPAGLPVAVTKPT
GETIRYERDQLGRVVRVMSSDGGTTALTWTTDGLPTSRTLPDGSTDSWAWDGEENLQRRT
SATGAVTSYAYGPFGQLMSITWPGGTRTELTYDRSCRVTSVTQSGMTWEFELESAGRLSA
QTDYNGATTQYWYDAAGQLVHRVNASGHEASFAYNPLGKLAYSHTAEGTETTFAHDPAGR
LVRAKNDDVDLVLVRDPLGRVITESCNGRTVTKTYDAAGRVTSRVTPSGASTSWSYDADG
TPSLLTADGHELRFGHDPAGRETRRDLPGGVVLTQEWDHNGRLVTQALTGSAAASGPDGP
VVTGQPLQRRAYTYSPDGSVAGRQDLLTGDRTFRLDSAGRVTAVTGRRDAWSEQYDFDPA
GNIVDALWPAPAAGSAAGTPETSAQGPRATDGTLTTRAGDIRYRYDAAGRVVTRTRTRAS
GDPDTWRYAWDADSRLHSVTLPDGSTWQYHYDPLGRRIGKRHLAADGRLLGQTQFTWDGD
VLVEQEDRHGDCRKVTTWNYRNDSCVPLTQASRTVVRVDAEREETDEEFHSVVTDLNGMP
TELVSPDGAVAGHQRYTWWGQSSWQHGTATTPLRFPGQYCDQETGLHYENQRYYDPEIGA
YLSPDPLGLAPASNPHAYVPNTARLRTADSWIGSLLPSSHLLTVSAGVEGLDARLFAGGR
AAGPHRAGEAELPELP
selected fasta
>hypothetical protein [hypothetical protein]
GTGGGGACGAAGATGCCTGACGTCAACGATCTCGTGGACGTGGCGACCGGCGACGCCACT
GTGGCCGAGACCGATGTCACGCTGCCCGGCGTCCTGCCCCTCGTGCTGGAGCGCGTCCAC
AGGTCCTCCACCCGGACAGGCCGGTGGTTCGGACGGTCCTGGACGTCGAGCCTCGACCAG
CGCCTGCACGTGACCGGCGGACAGATCCACGCGAGGTTCGCCGGCGGACAGACCCTGACC
TTCACCTCTCCGGGCAGCGCCGGTGATCCCCCCGCTGTCCCGGTGACCGGCCCGGCATGG
CCGCTGCGGCAGAACCCGGACGGCTCCTACGCCATCAGCGACCCGCAGCGCGGCCTCACC
TGGCGGTTCGAACGCCGGCCCGGATACGAGGACGACGAACTGCCTCTGGTCTCGCTCACG
GACCGGACGGGCCACGAGATCACCTTCAGCTACGACGCTGTCGGCAGGCCGCTCAGCATC
ACCCACTCCGGCGGCTACCGCGTCCTGGTGACGGTCACCGACGAGCGCATCACCGCGCTG
GCCCTCGCCGGCCGCGGCGGCCAGGACGACATCCCGCTGCGACGCTTCGAATACGACGAT
TCCGGCAACCTGTCCGGCGTCGTCAATTCCTCCGGCCTGCCGCGGCGCTTCACTTACGAC
GACATGGGTCGTCTGACCGGCTGGACCGACCGTAACGGCTACTCCTACCACTACACCTTC
GACTCCGAAGGCCGGTGCGTCCGGGGAGAAGGCCCCGACGGTGTCCTGTCCGGCACCTTC
GTCTACGAGCCCGGCGTCACTCGCTGGACCACCACCGACGGGGATGTCACCACCTACGCG
ATCAACGAGTCCGCCCACGTCGTCGCGGTCACCGACCCGATCGGGAAGACGACGCGGACG
CAGTACGACGAACGCGGCCGTGTCACCGTCCGCACCGACCCCCTCGACAGGGTCACTCGA
CATGCCTACGACGAGCGCGGCAACCTGGTCTCGGTGACCGATCCGGCGGGCCACGAATAC
CACGTCTACGTCAACGACGCCTGCCTCCCGGAACGGATCACCGCACCGGACGGAACTGTC
TGGCTCCAGGATTTCGACAAGAACGGCAATCTCACCGAACAGACCGCACCCGACGGCTCG
GTGCTCACCTACGCGTACGACAGCCGCGGGCACCTCAGCCGGATGACCGGCGCGGACGGC
GCGGTCACCACGATCGCATGCGATCCGGCCGGATTGCCCGTGGCCGTCACCAAACCCACC
GGTGAAACGATCCGGTACGAGCGCGACCAGCTGGGACGAGTCGTGCGTGTCATGAGCTCC
GACGGCGGGACGACGGCCCTCACCTGGACGACGGACGGCCTCCCCACCTCCCGGACCCTG
CCGGACGGGTCGACCGACTCCTGGGCCTGGGACGGCGAGGAGAACCTCCAGCGGCGAACC
TCCGCCACGGGAGCGGTCACGTCATACGCCTACGGGCCATTCGGTCAACTGATGTCGATC
ACCTGGCCGGGTGGCACCCGCACCGAGCTCACGTACGACCGCAGCTGTCGTGTCACCTCG
GTGACCCAATCCGGGATGACGTGGGAATTCGAGCTGGAGTCCGCCGGCCGGCTGAGCGCG
CAGACCGACTACAACGGAGCCACCACCCAGTACTGGTACGACGCCGCAGGACAGCTCGTA
CACCGCGTGAACGCCAGCGGCCATGAGGCCTCGTTCGCCTACAACCCCCTGGGCAAGCTG
GCGTATTCGCACACCGCAGAGGGCACGGAGACGACGTTCGCGCACGATCCGGCAGGCCGC
CTCGTGCGGGCGAAGAACGACGACGTGGACCTGGTCCTCGTCAGGGACCCGCTCGGACGG
GTGATCACCGAAAGCTGCAACGGCCGCACGGTCACCAAGACCTACGACGCGGCCGGAAGG
GTGACGAGCCGCGTCACTCCGTCCGGGGCCAGTACGTCGTGGTCCTACGACGCGGACGGA
ACGCCCTCGCTCCTCACCGCCGACGGCCATGAACTGCGCTTCGGCCATGACCCCGCCGGA
CGGGAAACCCGCCGGGACCTGCCCGGGGGAGTAGTCCTCACCCAGGAGTGGGACCACAAC
GGTCGTCTCGTGACGCAGGCGCTCACCGGCTCGGCCGCCGCCTCCGGTCCGGACGGACCC
GTGGTCACGGGGCAACCGCTCCAACGGCGCGCGTACACCTACAGCCCGGACGGGTCCGTC
GCGGGCCGGCAGGACCTGCTCACCGGCGACCGGACGTTCCGTCTCGACTCCGCCGGGCGG
GTCACCGCAGTGACCGGCCGGCGTGACGCATGGTCGGAACAGTACGACTTCGATCCCGCG
GGCAACATCGTCGACGCCCTCTGGCCGGCCCCGGCAGCCGGTTCTGCCGCCGGAACACCG
GAGACGTCAGCGCAAGGGCCCCGCGCGACCGACGGAACCCTCACCACGCGGGCCGGCGAC
ATCCGCTACCGCTACGACGCCGCCGGGCGCGTCGTCACGCGGACGCGGACACGGGCATCC
GGCGATCCCGACACCTGGCGCTATGCGTGGGACGCCGACAGCCGGCTCCACTCCGTCACC
CTCCCCGACGGAAGCACGTGGCAGTATCACTACGATCCCCTCGGCCGCCGCATCGGCAAG
CGTCATCTCGCCGCCGACGGCCGGCTCCTGGGACAGACACAGTTCACGTGGGACGGGGAC
GTCCTCGTCGAGCAGGAGGACCGCCACGGCGACTGCCGGAAAGTCACCACATGGAACTAC
CGCAACGACTCGTGCGTCCCGCTCACCCAGGCCTCACGAACCGTCGTCCGCGTGGACGCC
GAAAGGGAGGAGACCGACGAGGAGTTCCACTCCGTCGTCACGGACCTGAACGGCATGCCG
ACCGAACTGGTCTCCCCCGACGGAGCCGTCGCCGGCCACCAGCGGTACACGTGGTGGGGG
CAATCCTCCTGGCAGCACGGCACCGCGACCACACCGCTGCGCTTTCCCGGCCAGTACTGC
GACCAGGAAACAGGACTGCACTACGAAAACCAGCGCTACTACGACCCCGAGATCGGCGCC
TACCTCTCACCCGACCCCCTCGGGCTGGCGCCCGCGTCGAACCCTCACGCCTACGTCCCG
AACACGGCGCGGCTGAGGACAGCGGACAGCTGGATCGGTTCTCTGCTCCCCTCCTCCCAT
CTCCTGACGGTTTCCGCAGGCGTCGAGGGCCTCGACGCGCGCCTGTTCGCGGGCGGCCGG
GCCGCCGGCCCCCACCGCGCAGGCGAAGCCGAACTCCCCGAACTCCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006530 YD repeat (Repeat)
 [136-165]  0.00036 PF05593 [198-233]  0.00041 PF05593 [287-314]  6.3e-06 PF05593 [302-338]  2e-10 PF05593 [365-401]  6e-09 PF05593 [470-506]  0.00041 PF05593 [534-568]  5.7e-07 PF05593 [616-650]  3.3e-06 PF05593 [635-660]  3.60000000000001e-05 PF05593 [850-878]  8.3e-05 PF05593
PF05593   RHS_repeat
 [136-167]  0.00087 TIGR01643 [198-238]  2.1e-06 TIGR01643 [286-320]  2e-06 TIGR01643 [302-339]  2.5e-07 TIGR01643 [346-381]  0.00082 TIGR01643 [366-404]  2e-06 TIGR01643 [407-448]  1.2e-07 TIGR01643 [470-510]  1.1e-05 TIGR01643 [512-552]  4.20000000000001e-05 TIGR01643 [553-592]  1.4e-05 TIGR01643 [574-603]  0.002 TIGR01643 [635-660]  7.19999999999999e-05 TIGR01643 [676-710]  0.00011 TIGR01643 [845-870]  0.00011 TIGR01643 [850-883]  2e-06 TIGR01643
TIGR01643   YD_repeat_2x
IPR015943 WD40/YVTN repeat-like-containing domain (Domain)
 [316-526]  0.00033 G3DSA:2.130.10.10
G3DSA:2.130.10.10   WD40/YVTN_repeat-like
IPR022385 Rhs repeat-associated core (Domain)
 [976-1041]  2.3e-18 TIGR03696
TIGR03696   Rhs_assc_core
SignalP No significant hit
TMHMM No significant hit