close all open/close all

CDS information : Rubra_00210


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction40,484 / 39,213 / - [in whole cluster]
40,484 / 39,213 / - [in contig]
Locationcomplement(39213..40484) [in whole cluster]
complement(39213..40484) [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-L-evernosamine nitrososynthase
FAD-dependent oxidoreductase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)rubN8
EC number
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[18983146] A unifying nitrososynthase involved in nitrosugar biosynthesis. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>dTDP-L-evernosamine nitrososynthase [hypothetical protein]
METEQAPRPAEPPGDLTTAITAPGEQLLTLLDRHLPRIRAQAAPNDRDSTFPAATFHGFA
RDGVLGATVPAELGGMGVSRLHDVAVALLRVAEADASTALALHAQFSRGITLTYEWLHGP
PPTRKLAERLLRAMARGEAVIGGAVKDHGRETTRLRPDGSGGWLLSGRKTLVTMAPIATH
FVVSAQAPAAGGTTLLYAPIVARDTPGLSIVDGWTGLGMRASGTLDVAFDDCPVPAGNLL
ARGSVGAHSDAALAGQAVSSVAMLGIYVGVAQAARDLAVETMARRSATPPAASRTLVAET
EARLYALRATASAALVNVDELSPRHDMDPDERGRRMMTPFQCAKVMVNQLAAAVVDDCLT
VVGGATYAAEHPLARLSRDVRAGRFMQPYTYADGVDYLSAQALGLERDNNYVSLRATRPV
DSR
selected fasta
>dTDP-L-evernosamine nitrososynthase [hypothetical protein]
ATGGAGACGGAACAGGCCCCCCGGCCGGCCGAGCCACCCGGCGACCTGACCACCGCCATC
ACCGCGCCAGGTGAACAGCTGCTGACCCTCCTGGACCGGCACCTGCCCCGGATACGCGCC
CAGGCGGCGCCGAACGACCGGGACAGCACCTTCCCCGCCGCGACGTTCCACGGCTTCGCG
CGCGACGGCGTGCTGGGCGCGACCGTGCCCGCCGAACTGGGAGGGATGGGCGTCAGCCGG
CTTCACGACGTGGCGGTCGCGCTTTTGCGGGTCGCCGAGGCGGACGCCTCGACCGCACTG
GCCTTGCACGCCCAGTTCAGCCGGGGAATCACCCTGACATACGAGTGGCTGCACGGCCCG
CCGCCGACCCGGAAACTGGCCGAGCGGCTGCTGCGCGCGATGGCCCGCGGCGAGGCGGTG
ATCGGCGGCGCGGTGAAGGACCACGGACGAGAGACCACCCGGCTGCGCCCCGACGGCTCC
GGTGGCTGGCTGCTGTCCGGACGCAAGACTCTGGTGACGATGGCGCCGATCGCGACGCAC
TTCGTCGTCTCCGCCCAGGCGCCGGCCGCCGGGGGAACAACGCTGCTGTACGCCCCCATC
GTGGCACGGGACACCCCGGGGCTCTCCATCGTCGACGGATGGACCGGCCTGGGCATGCGG
GCGTCCGGCACGCTCGACGTGGCGTTCGACGACTGCCCGGTGCCCGCCGGAAACCTGCTG
GCGCGTGGCAGCGTCGGCGCGCACAGCGACGCGGCCCTCGCCGGGCAGGCGGTCAGCTCC
GTCGCCATGCTCGGCATCTACGTCGGCGTCGCCCAGGCCGCCCGCGACCTCGCGGTGGAG
ACCATGGCCCGGCGGTCGGCCACACCGCCCGCGGCCTCACGCACCCTGGTCGCCGAGACC
GAGGCGCGGCTGTACGCGCTGCGGGCCACCGCATCGGCTGCGCTCGTCAACGTCGACGAA
CTGTCGCCACGTCACGACATGGATCCCGATGAGCGCGGCCGGCGGATGATGACCCCGTTC
CAGTGCGCCAAAGTCATGGTCAACCAACTGGCGGCCGCGGTGGTCGACGACTGCCTCACC
GTGGTGGGCGGGGCCACCTACGCGGCGGAGCACCCGCTGGCCCGGCTGTCCCGGGACGTG
CGGGCCGGCCGGTTCATGCAGCCGTACACGTACGCCGACGGGGTCGACTACCTGAGCGCC
CAGGCGCTCGGTTTGGAAAGAGACAACAACTACGTGAGCCTGCGGGCCACCCGGCCGGTG
GACAGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [261-386]  2.3e-09 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [150-233]  2.2e-20 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [152-186]  2.4e-07 PF02770
PF02770   Acyl-CoA_dh_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [37-138]  1.5e-09 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [246-388]  2.19999900980708e-12 SSF47203
SSF47203   AcylCoADH_C_like
 [234-408]  7e-23 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [16-243]  8.30001403791594e-39 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [18-107]  1.9e-13 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP
 [1-42]  0.194 Signal
Bacteria, Gram-positive   
TMHMM No significant hit