close all open/close all

CDS information : Rubra_00220


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction41,782 / 40,547 / - [in whole cluster]
41,782 / 40,547 / - [in contig]
Locationcomplement(40547..41782) [in whole cluster]
complement(40547..41782) [in contig]
TypeCDS
Length1,236 bp (411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 C-methyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)rubN5
EC number2.1.1.-
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
P96561
NITE
Chlor_00150
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 C-methyltransferase [hypothetical protein]
MPRERATVTCRVCDGTVHEFLDLGRQPLSDAFREPDCDTEEFFFRLAVGQCESCTMVQLT
ESVPRDKMFHEDYPYHSSGSAVMREHFAGVARRFLATELAAPDPFIVEMGCNDGVMLSTI
HQAGVRHLGFEPSGRVAELARTKGVRVLTEFFEDSTAARIREAEGPAQVIFAANTMCHIP
YPNSVFRGVDALLAPDGVFVFEDPYLGDLVEKTSFDQIYDEHFFLFSAHSVRAMAEHHGF
ELVDVERLPVHGGEVRYTLARTGGRTPSAAVADLLAEEDARGLSDMETLRGFAAGVMRVR
DDLVALLRRLRTEGSSVVAYGATAKSATVTNFCDIGPELVSYVCDSTPAKQHRMTPGKHI
PVRPPTAFRDPYPDYALLFAWNHADEIMANEQEFRRSGGRWISYVPNVRVL
selected fasta
>putative NDP-hexose C-3 C-methyltransferase [hypothetical protein]
ATGCCGCGAGAACGGGCGACCGTCACCTGCAGAGTGTGCGACGGGACAGTCCACGAGTTC
CTCGACCTCGGCCGTCAGCCGCTGTCCGACGCGTTCCGGGAACCGGACTGCGACACCGAG
GAGTTCTTCTTCCGGCTCGCCGTCGGGCAATGCGAGTCGTGCACGATGGTGCAGCTCACC
GAGTCGGTACCGCGGGACAAGATGTTCCACGAGGACTACCCGTACCACTCGTCCGGGTCG
GCGGTGATGCGGGAGCACTTCGCGGGTGTCGCACGACGGTTCCTCGCCACCGAGTTGGCC
GCGCCGGACCCGTTCATCGTCGAGATGGGCTGCAACGACGGCGTCATGCTGAGCACGATC
CACCAGGCAGGCGTACGCCACCTGGGCTTCGAACCTTCCGGGCGGGTGGCCGAGCTGGCC
CGCACCAAGGGCGTCCGGGTCCTCACCGAGTTCTTCGAGGACTCGACAGCGGCGCGGATC
CGCGAGGCGGAAGGGCCCGCCCAGGTCATCTTCGCGGCGAACACCATGTGCCACATCCCG
TACCCGAACTCGGTCTTCCGCGGAGTCGACGCACTGCTGGCACCGGACGGCGTGTTCGTG
TTCGAGGACCCCTACCTCGGCGACCTGGTGGAGAAGACGTCCTTCGACCAGATCTACGAC
GAGCACTTCTTCCTGTTCAGCGCCCACTCGGTGCGGGCCATGGCCGAGCACCACGGATTC
GAGCTGGTCGACGTGGAACGCCTGCCGGTGCACGGCGGCGAGGTCCGGTACACGCTCGCC
CGGACCGGCGGACGCACACCCAGCGCCGCCGTCGCCGACCTGCTCGCCGAGGAGGACGCC
CGCGGGCTGTCCGACATGGAGACGCTGCGTGGCTTCGCCGCCGGCGTGATGCGCGTGCGC
GACGACCTGGTGGCACTGCTGCGACGGCTGCGCACCGAAGGATCCAGCGTGGTCGCCTAC
GGCGCCACGGCGAAAAGCGCCACAGTCACCAACTTCTGCGACATCGGGCCCGAACTCGTC
TCCTACGTGTGTGACAGCACGCCCGCCAAGCAGCACCGCATGACGCCCGGCAAGCACATC
CCCGTACGCCCGCCGACCGCGTTCCGCGACCCGTACCCGGACTACGCGCTGCTGTTCGCG
TGGAACCACGCCGACGAAATCATGGCGAACGAACAGGAGTTCCGGCGCTCCGGCGGCCGA
TGGATCAGCTATGTGCCGAACGTCCGGGTGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [10-70]  1.4e-20 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [248-406]  1.80000000000002e-51 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit