close all open/close all

CDS information : Rubra_00230


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction42,933 / 41,812 / - [in whole cluster]
42,933 / 41,812 / - [in contig]
Locationcomplement(41812..42933) [in whole cluster]
complement(41812..42933) [in contig]
TypeCDS
Length1,122 bp (373 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-3 aminotransferase
Product (GenBank)putative aminotransferase
Gene
Gene (GenBank)rubN4
EC number2.6.1.-
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)

close this sectionSequence

selected fasta
>NDP-hexose C-3 aminotransferase [putative aminotransferase]
MTIRVWDYLPEYHEEREEVLAAVTKVFESGQLILGPSVAGFEAEFAAYHGAAHCAGVDNG
TNAVKLGLQALGVGKGDEVITVANTAAPTVVAIDGTGAKPVFVDVREDDFLMDTDQVAAA
IGPRTRALVPVHLYGQCVDMAPLRRLADRHSLAILEDCAQAHGARHHGRLAGTMGDVAAF
SFYPTKVLGAYGDGGAVITGDEDTDRNVRRLRYYGMEDRYFVERVPGHNSRLDEVQAEIL
RGKLRRLDAYISKRRDIARLYTKALGDLAEPGGLVLPTVSFGNEHVYYLYVVRHPRRDEI
IERLRAYGIALNISYPWPVHTMAGFAHLGCARGSLPVTEKLAGEVFSLPMYPSLPLDRQQ
TVIQALREVLAGF
selected fasta
>NDP-hexose C-3 aminotransferase [putative aminotransferase]
GTGACGATCCGGGTATGGGACTACCTGCCGGAGTACCACGAGGAACGCGAGGAGGTACTC
GCGGCGGTGACGAAGGTGTTCGAGTCCGGCCAGCTGATACTGGGTCCCAGCGTGGCCGGG
TTCGAGGCCGAGTTCGCGGCGTACCACGGCGCCGCCCACTGCGCCGGCGTCGACAACGGC
ACCAACGCGGTCAAGCTGGGGCTGCAGGCGCTCGGCGTGGGCAAGGGCGATGAGGTGATC
ACCGTCGCCAACACCGCCGCGCCGACCGTGGTGGCCATCGACGGGACGGGCGCGAAGCCG
GTCTTCGTGGATGTACGCGAGGACGACTTCCTCATGGACACCGACCAGGTCGCGGCCGCG
ATCGGCCCGCGCACACGGGCACTGGTCCCCGTGCACCTCTATGGCCAGTGCGTCGACATG
GCCCCGCTGCGCCGGCTCGCCGACCGCCACAGCCTGGCCATCCTCGAGGACTGCGCCCAA
GCGCACGGCGCGCGCCACCACGGCCGGCTGGCAGGCACGATGGGCGACGTCGCCGCCTTC
TCCTTCTATCCCACGAAGGTTCTCGGCGCGTACGGCGACGGTGGCGCCGTGATCACCGGC
GACGAGGACACCGACCGCAACGTCCGGCGCCTGCGCTACTACGGCATGGAAGACCGCTAC
TTCGTGGAGCGGGTTCCCGGACACAACAGCCGCCTCGACGAGGTACAGGCCGAGATTCTG
CGGGGCAAGCTGCGCCGGCTCGACGCGTACATCTCCAAGCGCCGCGACATCGCGCGGCTC
TACACCAAGGCGCTGGGCGACCTCGCCGAACCGGGCGGCCTCGTCCTGCCGACGGTCTCC
TTTGGCAATGAGCACGTGTACTACCTGTACGTCGTTCGGCACCCCAGGCGGGACGAGATC
ATCGAACGGCTGCGCGCGTACGGCATCGCGCTGAACATCAGCTACCCCTGGCCGGTGCAC
ACGATGGCCGGATTCGCGCACCTCGGATGCGCCAGGGGCTCGCTGCCGGTCACCGAGAAA
CTGGCAGGCGAGGTGTTTTCGCTGCCGATGTACCCGTCGCTGCCGTTGGACCGGCAGCAG
ACGGTGATCCAGGCCCTGCGCGAGGTGCTGGCCGGATTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-373]  1.3000049540733e-94 PIRSF000390
PIRSF000390   PLP_StrS
 [15-367]  4.59999999999996e-117 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-246]  1.20000000000001e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [247-370]  1.6e-36 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [6-373]  1.3000049540733e-105 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit