close all open/close all

CDS information : Rubra_00240


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction43,957 / 43,157 / - [in whole cluster]
43,957 / 43,157 / - [in contig]
Locationcomplement(43157..43957) [in whole cluster]
complement(43157..43957) [in contig]
TypeCDS
Length801 bp (266 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative regulator
Gene
Gene (GenBank)rubRg1
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q9XCC4
PmId
[11985721] Differential roles of two SARP-encoding regulatory genes during tylosin biosynthesis. (Mol Microbiol. , 2002)
[16942604] Regulation of tylosin biosynthesis involving 'SARP-helper' activity. (Mol Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative regulator]
MIFRVLGPLEVAVEGAAEKPSAPKVRWTLALLLLHANQVVGHSSILYELWGENPPCSAVA
TAQTYVYQIRKKYQRRFDRIGWGALVETRPSGYVLRAEESEIDAQVFERLSERARASLTA
GHTEQAARQLREALALWRGRALADVSAGSVLAPRIMHLEKSRMRTLRLRIFADQRLGRHR
ELLPELQFLAAANPLDEWFHQQLMIALVETGRRADALEAYHRLQSTLGAELGVRPSPRLH
KLRHDVLTGVPWTRGPQSELDLTVPS
selected fasta
>putative transcriptional regulator [putative regulator]
ATGATATTCCGCGTACTCGGCCCGCTGGAGGTCGCAGTGGAGGGCGCCGCCGAAAAGCCC
TCGGCACCCAAGGTCCGCTGGACACTCGCCCTGCTGCTGCTTCACGCGAACCAGGTCGTC
GGCCACTCCTCGATCCTTTACGAGTTGTGGGGCGAAAACCCCCCGTGCAGTGCCGTCGCC
ACCGCGCAGACCTACGTCTACCAGATACGCAAGAAATATCAGCGCCGGTTCGACCGGATC
GGCTGGGGCGCATTGGTGGAGACCCGTCCGTCCGGGTACGTGCTCCGGGCGGAAGAGTCG
GAGATCGACGCGCAGGTGTTCGAGCGGTTGAGCGAGCGGGCGCGCGCGTCGCTGACGGCG
GGGCACACCGAGCAGGCCGCGCGGCAGCTGCGCGAGGCGCTCGCACTGTGGCGCGGGCGA
GCGCTGGCGGATGTCTCGGCGGGATCGGTGCTGGCGCCGCGCATCATGCACCTGGAGAAG
AGCCGGATGCGGACGCTGCGGTTGCGCATCTTCGCCGATCAGCGGCTCGGCCGCCACCGT
GAGCTGCTCCCGGAACTGCAGTTCCTCGCGGCCGCCAACCCCCTCGACGAGTGGTTCCAC
CAGCAGTTGATGATCGCGCTCGTCGAGACGGGCCGGCGTGCCGACGCCCTGGAGGCGTAT
CACCGGCTGCAGTCCACCCTCGGCGCGGAGCTGGGCGTGCGGCCCTCGCCGAGGCTGCAC
AAGCTCCGGCACGACGTGCTCACCGGAGTGCCATGGACGCGGGGGCCCCAGAGCGAGCTG
GACCTGACGGTGCCGAGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-95]  3.89999861795218e-06 SM00862
SM00862   Trans_reg_C
 [20-95]  1.7e-09 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [102-247]  6.09999999999996e-46 PF03704
PF03704   BTAD
 [102-247]  7.79998304125571e-47 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [101-220]  4.29999999999999e-06 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [28-98]  1.1e-05 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [3-96]  1.59999889349252e-10 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-41]  0.712 Signal
Eukaryota   
TMHMM No significant hit