close all open/close all

CDS information : Rubra_00260


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction45,427 / 46,269 / + [in whole cluster]
45,427 / 46,269 / + [in contig]
Location45427..46269 [in whole cluster]
45427..46269 [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative quinone oxidoreductase
Gene
Gene (GenBank)rubF2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR013149

close this sectionSequence

selected fasta
>putative oxidoreductase [putative quinone oxidoreductase]
MKAIIYSSIGKSDVLRFVDRERIGQRVWVWEAAYKRPHGTAAEYAVVPSRQAVPLPAQVS
FETGACFGLPAVAAQRCLLAGQKGPDRLGPGALSGRTVLVAGGAGAVGHTAIQLGAWSGA
TVIATVSGPKKAEMARRAGAAHTVEYRSQTAQSDIRALAPQGVDLIVEVAATENIATHLE
VLAPNGTVAAYGTEGDSVLAFPTKKAIGRNLRFQFVLAMTLSAADKDLASADITRAAADG
ALAVGEEAGLPIHRFPLQRTGEAQDAVQAGVLGKVVVEIG
selected fasta
>putative oxidoreductase [putative quinone oxidoreductase]
ATGAAAGCGATCATATATTCGTCAATCGGCAAGAGTGACGTTCTCCGATTCGTCGACCGG
GAACGGATCGGCCAGCGGGTGTGGGTGTGGGAGGCGGCGTACAAGCGGCCCCACGGCACC
GCCGCGGAATACGCCGTCGTCCCCTCCCGCCAGGCGGTCCCCCTGCCGGCGCAGGTCTCG
TTCGAGACCGGTGCCTGCTTCGGCCTGCCGGCGGTCGCCGCCCAACGCTGCCTGCTCGCC
GGGCAGAAGGGCCCCGACCGTCTCGGCCCCGGCGCCCTGAGCGGGCGGACCGTGCTGGTC
GCCGGCGGCGCCGGAGCCGTGGGGCATACCGCGATCCAGCTCGGCGCCTGGTCCGGGGCG
ACCGTGATCGCGACGGTCAGCGGCCCGAAGAAGGCGGAAATGGCCCGCCGCGCCGGCGCG
GCGCACACCGTCGAGTACCGGTCGCAGACGGCCCAGTCCGACATCCGCGCCCTCGCGCCG
CAGGGGGTGGACCTCATCGTCGAGGTGGCGGCGACGGAGAACATCGCCACCCACCTGGAG
GTCCTCGCCCCGAACGGCACCGTCGCCGCGTACGGCACCGAGGGGGACAGCGTGCTGGCG
TTCCCGACCAAGAAGGCGATCGGCCGGAACCTGCGCTTTCAGTTCGTGCTGGCGATGACG
CTGTCCGCGGCCGACAAGGACCTCGCGTCGGCCGACATCACGAGGGCGGCGGCCGACGGG
GCACTCGCTGTGGGAGAGGAAGCCGGGCTGCCGATCCACCGGTTCCCGCTCCAGCGCACC
GGCGAGGCACAGGACGCCGTGCAGGCCGGCGTCCTCGGCAAGGTCGTCGTCGAGATCGGC
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [18-279]  6.00000361638163e-10 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [106-223]  1e-20 PF00107
PF00107   ADH_zinc_N
IPR016040 NAD(P)-binding domain (Domain)
 [104-242]  4.10000000000001e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit