close all open/close all

CDS information : Rubra_00270


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction46,312 / 47,106 / + [in whole cluster]
46,312 / 47,106 / + [in contig]
Location46312..47106 [in whole cluster]
46312..47106 [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative amide synthase
Product (GenBank)putative amide synthase
Gene
Gene (GenBank)rubF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52547
NITE
Rifam_00260
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[11812235] Expression and purification of the rifamycin amide synthase, RifF, an enzyme homologous to the prokaryotic arylamine N-acetyltransferases. (Protein Expr Purif. , 2002)

close this sectionSequence

selected fasta
>putative amide synthase [putative amide synthase]
MYDSDTYLRRLGYDPAAGRPAADLATLVALHKRHMETVPFNSAGSLAVPAASGRLVDLVD
FDEDATFDSVVAAGNGGGCVQMTRLFLRLLRDLGFDADLIAGTTAEGRQSYGVEVEHMLI
LARVDGGSWLADIGYAGPSFVEPLRLDGAPGDQRQYGCRYRLIPGRDGVTLQRRPRLGQW
STVYEFTTHVRDRSDWAPAEKAINAALAAGGGGELYSRAVPDGQVVLKGRRYLTVRAGIE
KTRTVTDDGDWHAYRSAILAGEVG
selected fasta
>putative amide synthase [putative amide synthase]
ATGTACGACAGCGACACGTACCTGCGGCGGCTGGGGTACGACCCCGCCGCCGGCAGACCG
GCCGCGGATCTGGCGACCCTCGTCGCACTGCACAAGCGGCATATGGAGACCGTTCCGTTC
AACAGTGCGGGCTCGCTGGCTGTGCCCGCTGCGAGCGGCAGGCTGGTCGATCTGGTCGAC
TTCGACGAGGACGCGACGTTCGATTCGGTGGTCGCGGCGGGCAACGGCGGCGGCTGCGTC
CAGATGACCCGGCTGTTCCTGCGGCTGCTGCGCGACCTCGGGTTCGATGCCGACCTGATC
GCCGGCACGACGGCGGAAGGCCGCCAGTCGTACGGCGTCGAGGTCGAGCACATGCTCATC
CTGGCCCGCGTGGACGGCGGGTCCTGGCTGGCCGACATCGGGTACGCCGGGCCGTCGTTC
GTCGAGCCGCTGCGCCTCGACGGCGCCCCCGGCGATCAACGCCAGTACGGCTGCCGGTAC
CGGCTCATCCCCGGCCGGGACGGTGTGACGCTGCAGCGCCGCCCCAGGCTCGGCCAGTGG
AGCACGGTCTACGAGTTCACCACGCACGTCCGCGACCGGTCGGACTGGGCGCCGGCGGAG
AAGGCGATCAACGCCGCGCTCGCCGCCGGCGGCGGCGGCGAGCTCTACAGCCGAGCGGTC
CCCGACGGCCAGGTGGTGCTGAAGGGCCGCCGCTATCTCACCGTCCGGGCCGGCATCGAG
AAGACCCGCACCGTCACCGACGACGGTGACTGGCACGCGTATCGCAGCGCCATCCTGGCC
GGCGAAGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001447 Arylamine N-acetyltransferase (Family)
 [23-252]  1.99999999999999e-44 PF00797
PF00797   Acetyltransf_2
SignalP No significant hit
TMHMM No significant hit