close all open/close all

CDS information : Rubra_00280


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction47,128 / 48,414 / + [in whole cluster]
47,128 / 48,414 / + [in contig]
Location47128..48414 [in whole cluster]
47128..48414 [in contig]
TypeCDS
Length1,287 bp (428 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)rubF3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MRRRIARSERMYVSEIRTQALQICVVRGGVDAGILDAAFTAVLAEAPGLRSRLEKDGDDY
YLSLLEPSELPRLHVRRNEPGARLEEYNKPLHLGGPLARAVLLTGTDEDVVMFGVDHAIS
DGRSATAFCNRIWQRYIDIQSGGYSAPKPQQQQWPAPLEDWLPPRSDAELDAYVQERLER
AEGAPVASLPFRAAGSLPPVPAESLMTSRRLRLTESQTTGLLAFAKHTGVSVNGLVAAAL
LAAVRAGLPEELADHRLSSFCTVDLRNQFAPGLGHEAMVPMVSWYRDLLHVPAGADLVKL
GHLFSTELRAGIERGDAAMEMQALDRLLPHPQLWPTSLVLTNVGRIDGPPSPKGLKIVDM
TKFPLSSRWDPERGAGPLLASPATIYGRFSIEMPYSTQCFTTAQMDSIHDHVRDSLLACA
DRAPGSRR
selected fasta
>hypothetical protein [hypothetical protein]
ATGCGCCGACGAATTGCCCGGTCGGAACGGATGTACGTCAGCGAGATCAGGACGCAGGCG
CTGCAGATCTGCGTGGTGCGCGGCGGCGTCGACGCCGGGATTCTGGACGCGGCCTTCACC
GCTGTCCTCGCGGAGGCGCCAGGTCTGCGCAGCCGTCTGGAGAAGGACGGCGACGACTAC
TACCTCAGCCTGCTGGAGCCGAGCGAGCTGCCGCGTCTGCACGTCCGGCGCAACGAGCCC
GGTGCGCGGCTTGAGGAGTACAACAAGCCGTTGCACCTCGGTGGCCCGCTCGCGCGTGCC
GTCCTGCTGACCGGCACCGACGAGGACGTCGTGATGTTCGGCGTCGACCACGCGATCTCC
GACGGCCGCAGCGCGACCGCGTTCTGCAACCGGATCTGGCAGCGTTACATCGACATCCAG
TCCGGCGGCTACTCGGCCCCAAAGCCGCAACAGCAGCAGTGGCCGGCGCCGCTCGAGGAC
TGGCTGCCGCCGCGCAGCGATGCCGAGCTCGACGCCTACGTCCAGGAGCGGCTCGAGCGG
GCCGAGGGGGCACCGGTGGCGTCTTTGCCGTTCCGGGCGGCCGGGTCCCTCCCGCCGGTG
CCGGCGGAGAGTCTGATGACCTCGCGCAGGCTCCGACTGACCGAATCGCAGACCACTGGT
CTGCTGGCCTTCGCCAAGCACACCGGAGTATCGGTGAACGGGTTGGTCGCCGCGGCACTG
TTGGCGGCCGTGCGCGCCGGCCTGCCCGAGGAACTGGCCGACCACCGGCTGTCCAGCTTC
TGCACGGTCGACCTGCGCAACCAGTTCGCGCCGGGACTCGGCCACGAGGCGATGGTGCCC
ATGGTCTCCTGGTACCGCGATCTGCTCCACGTGCCCGCCGGCGCCGACCTGGTCAAGCTC
GGCCACCTGTTCAGCACCGAGCTGCGCGCCGGCATCGAGCGGGGTGACGCGGCGATGGAG
ATGCAGGCACTGGACCGGTTGCTCCCCCACCCCCAGCTCTGGCCGACCAGCCTGGTGCTC
ACCAACGTCGGAAGAATCGACGGGCCGCCGTCGCCGAAGGGGCTGAAGATCGTCGACATG
ACCAAGTTCCCGCTGTCCAGCCGGTGGGACCCGGAGCGCGGTGCGGGCCCGTTGCTCGCG
TCGCCGGCAACGATCTACGGCCGGTTCAGCATCGAGATGCCGTACAGCACGCAGTGCTTC
ACGACCGCGCAGATGGACTCGATCCACGACCACGTCCGCGATTCGCTGCTGGCATGCGCT
GATCGGGCCCCCGGTTCACGGCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [27-244]  1.1e-13 PF00668
PF00668   Condensation
SignalP No significant hit
TMHMM No significant hit