close all open/close all

CDS information : Rubra_00290


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction49,686 / 48,466 / - [in whole cluster]
49,686 / 48,466 / - [in contig]
Locationcomplement(48466..49686) [in whole cluster]
complement(48466..49686) [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450
Gene
Gene (GenBank)rubF4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
A6YRR3
PmId
[19376895] Characterization of P450 FcpC, the enzyme responsible for bioconversion of diosgenone to isonuatigenone in Streptomyces virginiae IBL-14. (Appl Environ Microbiol. , 2009)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450]
MTEGIPEPISYLRHWDRTEPFDPPAVLGELVRTRPLARMVYPDGHVGWLATSHELAREVL
GSQAFSHRFHTTHAPVTKKGEIFPSVPIVPGGFIHMDPPEHTRYRNLLSSEFSARATAAY
APRVAELAAAQLAQVRQHGSPVDLLPTYVRPLSLRVLCEVLGVPFTGSPVLSALSDSATD
DEVSLEAEREAGTRAYHYLLDLVGKARVEPGENVTGRLAADPELTDREITNMLLIVFAAG
FASCEGALASSLLALLHHRDQLDRLRSAARSGGADGIEKMVEELLRYTSVNQFQIFRTAL
SDVELGGELVREGETVTVALPAANRDPARFGCPDGLDVSQDASAHLAFGYGVHACVGQRL
ARLVLAEGLTALVLGFPGLALDVPLREVPVRLKTPVLGVLRLPVRY
selected fasta
>putative cytochrome P450 [putative cytochrome P450]
ATGACTGAGGGAATCCCGGAACCGATCTCCTATCTGCGGCACTGGGACCGCACCGAACCG
TTCGATCCGCCGGCGGTGCTCGGTGAGCTGGTCCGGACGCGGCCACTGGCCCGGATGGTG
TATCCGGACGGTCACGTCGGCTGGCTGGCCACCAGCCACGAGCTCGCGCGTGAGGTGCTC
GGCAGCCAGGCGTTCAGCCACCGCTTCCACACCACACACGCCCCGGTGACGAAGAAGGGC
GAGATCTTCCCCTCCGTGCCCATCGTGCCGGGCGGGTTCATCCACATGGATCCGCCGGAG
CACACCCGCTACCGGAATCTGCTCAGCAGCGAGTTCAGTGCCCGCGCCACCGCGGCGTAC
GCCCCGCGGGTGGCCGAGCTGGCCGCCGCGCAGCTCGCCCAGGTACGGCAGCACGGCTCA
CCGGTCGACCTCCTGCCGACGTACGTCCGGCCGCTCTCGCTGCGGGTGTTGTGCGAGGTG
CTGGGGGTCCCGTTCACCGGCAGCCCGGTCCTGTCCGCTCTGAGCGACAGCGCCACCGAC
GACGAGGTCAGCCTCGAGGCGGAGCGGGAGGCCGGGACCCGGGCGTACCACTACCTCCTG
GACCTCGTGGGCAAGGCACGGGTCGAGCCGGGCGAGAACGTCACCGGGCGGTTGGCCGCC
GACCCCGAGCTGACCGACCGCGAGATCACCAACATGCTGCTGATCGTCTTCGCGGCGGGC
TTCGCCAGCTGCGAGGGCGCGCTCGCGTCGTCGTTGCTGGCGCTGCTGCACCACCGCGAC
CAGCTCGACAGGCTGCGTTCGGCCGCCCGGAGCGGCGGCGCCGACGGGATCGAGAAAATG
GTCGAGGAGCTGCTGCGGTACACCTCGGTCAACCAGTTCCAGATCTTCCGGACCGCACTG
TCCGATGTGGAACTCGGCGGGGAACTGGTCCGCGAGGGGGAGACGGTGACGGTCGCCTTG
CCGGCGGCCAACCGTGATCCGGCCAGGTTCGGCTGTCCCGACGGGCTGGATGTGAGCCAG
GACGCTTCCGCCCACCTGGCCTTCGGATACGGCGTACACGCCTGCGTCGGACAGCGGCTG
GCCCGGCTCGTCCTGGCCGAGGGGCTGACCGCGCTGGTGCTCGGCTTCCCCGGACTCGCC
CTGGACGTGCCGCTGCGGGAGGTTCCGGTACGGCTGAAGACCCCGGTGCTGGGCGTACTG
CGCCTGCCCGTGCGCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [8-405]  1.39999999999997e-78 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [1-406]  3.39999972437719e-70 SSF48264
SSF48264   Cytochrome_P450
 [222-376]  8.59999999999999e-17 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [96-107]  6.00001679190159e-44 PR00359 [143-159]  6.00001679190159e-44 PR00359 [160-175]  6.00001679190159e-44 PR00359 [197-219]  6.00001679190159e-44 PR00359 [279-290]  6.00001679190159e-44 PR00359 [297-324]  6.00001679190159e-44 PR00359 [325-340]  6.00001679190159e-44 PR00359 [346-355]  6.00001679190159e-44 PR00359 [355-366]  6.00001679190159e-44 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [348-357]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit