close all open/close all

CDS information : Rubra_00300


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction51,389 / 49,716 / - [in whole cluster]
51,389 / 49,716 / - [in contig]
Locationcomplement(49716..51389) [in whole cluster]
complement(49716..51389) [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ligase
Product (GenBank)putative acid AMP ligase
Gene
Gene (GenBank)rubF5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
P38135
PmId
[12535077] A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway. (Mol Microbiol. , 2003)
[15213221] The Escherichia coli fadK (ydiD) gene encodes an anerobically regulated short chain acyl-CoA synthetase. (J Biol Chem. , 2004)
ACC
Q8GA86
PmId
[11112781] The dhb operon of Bacillus subtilis encodes the biosynthetic template for the catecholic siderophore 2,3-dihydroxybenzoate-glycine-threonine trimeric ester bacillibactin. (J Biol Chem. , 2001)
[12221282] Crystal structure of DhbE, an archetype for aryl acid activating domains of modular nonribosomal peptide synthetases. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>putative ligase [putative acid AMP ligase]
MDLGQAQTRKSLVNRTSARYTDHVSADQRQAWAAAGHYPGQDLYSLFRGHVQRTPQAPAV
LDAEGTVSYGELDQAARRLAAGLVQLGIVPGDVVAVQLPNARLACAVDLAVAAVGAVVLP
FPLGRGDRDAVSLLRRSEAVAVITVADHHGYPCAERIRKHADALPMLRAVIVAGDGAAKT
PDCVPIEALAAATADEFVPRESDPDAPARILVTSGSEAEPKMVLYSHNALAGGRGAMMAG
LHRGSPATMRNLFLVPLASAFGSSGTPVTLATLGGTLVLRPSFDAAGTLRTIAETRPTHL
LGVPTMLRMLLDRPEIQDTDLSSLQAAVLGGAALDLDTARRAEELLGCTVVSLYGSADGV
SCNSGLALYDGTVGRPDPAVADIRIVDPDGIELPGGATGEVVARGPMSPMSYLNSPELDA
SLRNPDGWTRTGDLGLIDDRGRLRIVGRRKDVVIRGGLNISPAEVESVLITHPAIRDVAC
VAVADPLYGERVCACVATSADLSLAEVTAHLAAAGMEPRKFPERLLLLAALPLSAAGKVD
RQALRAQAANQGSGTTR
selected fasta
>putative ligase [putative acid AMP ligase]
ATGGATCTCGGTCAGGCTCAGACCAGGAAGAGTCTCGTGAACCGCACCTCAGCCCGGTAT
ACCGACCACGTTTCCGCCGACCAGCGCCAGGCCTGGGCCGCCGCGGGCCACTACCCGGGC
CAGGACCTGTACTCCCTGTTCCGTGGCCACGTCCAGCGCACGCCTCAGGCGCCGGCCGTG
CTGGACGCCGAGGGTACGGTCAGCTACGGCGAACTGGACCAGGCAGCCCGGCGCCTGGCC
GCGGGACTGGTGCAGCTCGGCATCGTCCCCGGCGACGTCGTGGCGGTCCAGCTGCCCAAC
GCCCGTCTCGCGTGTGCCGTCGACCTCGCCGTCGCCGCGGTGGGCGCCGTCGTGCTGCCG
TTTCCGCTCGGCCGGGGCGACCGGGACGCGGTCAGCCTGCTACGCCGCTCCGAGGCGGTC
GCGGTGATCACCGTCGCCGATCATCACGGCTATCCCTGCGCCGAGCGGATCCGGAAACAC
GCCGACGCCCTGCCGATGCTGCGTGCCGTCATCGTCGCCGGGGACGGTGCCGCCAAGACG
CCGGACTGCGTGCCGATCGAGGCCCTGGCCGCCGCCACCGCCGACGAGTTCGTGCCGCGG
GAATCCGACCCCGACGCACCGGCACGGATCCTGGTCACCTCCGGGTCCGAGGCGGAACCG
AAGATGGTCCTGTACTCGCACAACGCGCTGGCCGGTGGCCGCGGTGCCATGATGGCCGGC
CTGCACCGAGGTTCCCCGGCCACGATGCGCAACCTCTTCCTCGTCCCGCTGGCGTCGGCC
TTCGGCTCCAGCGGGACGCCGGTCACCCTCGCGACCCTGGGCGGAACCCTCGTGCTGAGG
CCGTCCTTCGACGCTGCCGGGACGCTGCGGACCATCGCCGAAACCCGGCCCACCCACCTG
CTGGGCGTGCCCACGATGCTGCGCATGCTGCTGGACCGCCCGGAGATCCAGGACACCGAC
CTCAGCTCCCTGCAGGCCGCGGTACTCGGTGGGGCCGCGCTCGACCTGGACACGGCGCGG
CGCGCCGAGGAGCTCCTGGGCTGCACAGTCGTCTCGCTGTACGGCTCGGCCGACGGCGTC
TCCTGCAACAGCGGTCTCGCCCTTTACGACGGTACGGTCGGCCGCCCCGACCCCGCCGTC
GCGGACATCCGCATCGTCGACCCGGACGGAATCGAGCTGCCCGGCGGAGCGACCGGCGAG
GTCGTCGCACGCGGCCCGATGTCGCCGATGAGCTACCTCAATTCCCCCGAGCTGGACGCC
TCGCTGCGCAACCCGGACGGATGGACCCGCACCGGAGATCTCGGGTTGATCGACGACCGG
GGCCGACTCCGGATCGTCGGACGCCGCAAGGACGTGGTCATCCGCGGCGGCCTCAACATC
AGCCCGGCGGAGGTCGAGTCGGTGCTGATCACGCATCCCGCGATCCGCGACGTGGCCTGC
GTAGCGGTGGCCGACCCGCTGTACGGCGAGCGCGTCTGCGCCTGCGTCGCCACCTCGGCC
GACCTGAGTCTGGCCGAGGTCACCGCCCACCTCGCCGCGGCCGGGATGGAGCCGCGGAAG
TTCCCCGAACGCCTGTTGCTGCTGGCTGCCCTGCCGCTGAGCGCTGCGGGAAAGGTGGAC
CGGCAAGCGCTTCGGGCCCAGGCCGCGAACCAGGGCTCCGGCACGACCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [68-480]  4.59999999999996e-86 PF00501
PF00501   AMP-binding
SignalP
 [1-18]  0.074 Signal
Eukaryota   
 [1-26]  0.184 Signal
Bacteria, Gram-positive   
TMHMM No significant hit