close all open/close all

CDS information : Rubra_00310


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction52,987 / 51,398 / - [in whole cluster]
52,987 / 51,398 / - [in contig]
Locationcomplement(51398..52987) [in whole cluster]
complement(51398..52987) [in contig]
TypeCDS
Length1,590 bp (529 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productaminocoumarin--carboxylic acid ligase
amide synthetase
Product (GenBank)putative aminocoumarin ligase
Gene
Gene (GenBank)rubF6
EC number
Keyword
  • inactive
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[21448870] Adenylate-forming enzymes of rubradirin biosynthesis: RubC1 is a bifunctional enzyme with aminocoumarin acyl ligase and tyrosine-activating domains. (Chembiochem. , 2011)
Related Reference
ACC
Q9L9F6
PmId
[10801869] Cloning, overexpression, and purification of novobiocic acid synthetase from Streptomyces spheroides NCIMB 11891. (J Biol Chem. , 2000)

close this sectionSequence

selected fasta
>aminocoumarin--carboxylic acid ligase [putative aminocoumarin ligase]
MSTTHVHYVQQLLTHFDADPDRLAVVSGEVPFSAGELADAVRRAAAAMGRHGVGRGDVVC
ILTEPNTAATLILQWAANLVGATAAHMRWVDPAGPEDELRAELQRALAADTGVRMLAVDP
ANEARARELLVNATGRPVLAVLGAGQPDTVDVSAGCGDGVGPCADITDGDVAVITQTRLP
SGRNGLCWTFGVRNDMLSAAPSLPSTAGASATGPTTLLITAPLIHTDVFTAEDTLVTGGM
VVLHPGFDAAAVLRAIAQHRVGRLMLGAPQLDALAEHPDRAATDLSSLTELIYTGSPGAP
LKLRKAREIFGPVLIQVYGTTETGVLTMLPPGDHDDLRACSSVGRPVDPGALSIRHPDTG
AVLPVGEVGEVCAVPRWPTAGYWHEPALTAALVRDGWVRTGDLGHLDTDGYLHLTGRLAN
MMKVKGIRIHPEQVEKVLRQAPGVSQAAVCGVEDADRVEHIYAAVVPEPGADPDPRELRR
HVAEALSDTYVPRLIDIRRKLPTTGWGKPDRVRLRADARAALTRPAPQA
selected fasta
>aminocoumarin--carboxylic acid ligase [putative aminocoumarin ligase]
ATGAGTACCACGCATGTGCATTATGTTCAGCAGCTGCTGACTCATTTCGATGCCGATCCG
GATCGCCTTGCCGTGGTCAGCGGGGAAGTCCCCTTCTCGGCCGGGGAGCTGGCCGACGCC
GTTCGCCGGGCCGCGGCCGCGATGGGCCGCCACGGCGTCGGCCGCGGTGACGTCGTCTGC
ATCCTGACCGAGCCGAACACCGCGGCCACGCTGATCCTGCAGTGGGCGGCCAACCTGGTG
GGGGCGACCGCCGCGCACATGCGCTGGGTGGACCCGGCCGGGCCCGAGGACGAGTTGCGC
GCGGAGCTGCAGCGCGCCCTGGCCGCGGATACCGGTGTCCGGATGCTGGCGGTCGACCCG
GCCAACGAGGCGCGGGCGCGGGAGCTGCTGGTGAACGCGACCGGTCGGCCGGTCCTGGCC
GTACTGGGCGCAGGGCAGCCGGACACGGTGGATGTGAGCGCCGGTTGCGGTGACGGAGTG
GGCCCGTGCGCGGACATCACCGACGGCGACGTCGCGGTGATCACCCAGACCAGGCTGCCG
AGCGGACGGAACGGCCTCTGCTGGACCTTCGGGGTCAGGAACGACATGCTCTCGGCCGCA
CCGTCCCTGCCCTCCACGGCCGGCGCGAGCGCGACCGGCCCGACGACCCTCCTGATCACC
GCACCGCTCATCCACACCGACGTGTTCACCGCGGAGGACACGCTCGTCACCGGCGGCATG
GTCGTCCTGCATCCCGGCTTCGACGCGGCGGCCGTGCTGCGTGCGATCGCGCAGCACCGC
GTCGGCCGGCTCATGCTCGGCGCTCCGCAACTGGACGCACTGGCCGAGCACCCGGACCGG
GCGGCCACCGACCTGTCCAGCCTGACCGAGCTGATCTACACCGGCAGCCCCGGGGCACCG
CTCAAGCTGCGCAAGGCCCGGGAAATCTTCGGCCCCGTACTGATCCAGGTCTACGGCACG
ACCGAGACCGGAGTGCTCACCATGCTCCCCCCCGGCGACCACGACGACCTGCGCGCCTGC
TCCAGCGTGGGCCGGCCGGTCGACCCCGGGGCGCTCAGCATCCGGCACCCCGACACCGGC
GCGGTGCTGCCCGTCGGCGAGGTCGGCGAGGTCTGCGCGGTTCCACGCTGGCCCACGGCC
GGCTACTGGCACGAGCCGGCGCTCACCGCGGCACTCGTCCGCGACGGCTGGGTGCGCACC
GGCGACCTCGGGCACCTCGACACCGACGGCTACCTGCACCTGACCGGCCGGCTCGCGAAC
ATGATGAAGGTCAAGGGAATCCGCATCCACCCCGAGCAGGTGGAGAAGGTGCTCAGGCAG
GCCCCGGGCGTGTCCCAGGCCGCCGTATGCGGGGTCGAGGACGCCGACCGGGTGGAGCAC
ATCTACGCCGCCGTCGTGCCCGAGCCCGGCGCCGACCCGGATCCCCGGGAACTGCGCCGT
CACGTCGCCGAGGCACTGTCCGACACCTACGTCCCCCGCCTGATCGACATTCGCCGGAAA
CTGCCGACGACCGGCTGGGGCAAACCCGATCGGGTCCGGCTGCGGGCCGACGCCCGCGCG
GCACTGACCCGGCCCGCCCCCCAGGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [35-449]  2.1e-52 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit