close all open/close all

CDS information : Rubra_00320


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction53,814 / 53,158 / - [in whole cluster]
53,814 / 53,158 / - [in contig]
Locationcomplement(53158..53814) [in whole cluster]
complement(53158..53814) [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative F420 dependent NADP reductase
Gene
Gene (GenBank)rubF7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative F420 dependent NADP reductase]
MTGFLIPDAPLPSARHLRLAIVGPDDCWAAALVEAFATVGRTVERLSLEELAPARTRAHQ
ADVAFLTIRTSQMPSLVPRLGDALKGVVTVICTTSLQHDESGYFMQPVHGGSATGLASEL
LPGSRVVGAFQQFGPSHLALAGMGVFETDVPVIGDDREACDVVEELIDEFRGLEPVYAGG
LKTAAAIEGLAALVGEATAGIGRPVGFRLSSGGIKILD
selected fasta
>hypothetical protein [putative F420 dependent NADP reductase]
ATGACCGGATTCCTCATCCCGGACGCGCCGCTGCCTTCGGCACGGCACCTCAGGCTGGCG
ATCGTCGGGCCTGACGACTGCTGGGCTGCCGCTCTGGTGGAGGCGTTCGCCACGGTAGGA
CGCACCGTCGAGCGGCTCTCCCTTGAGGAGTTGGCGCCGGCCAGAACGCGAGCACACCAG
GCCGACGTGGCGTTCCTGACCATCCGCACCTCCCAGATGCCGTCGCTGGTCCCCCGGTTG
GGCGACGCGCTGAAGGGCGTCGTCACGGTGATATGCACGACATCGCTTCAGCATGACGAG
AGCGGCTACTTCATGCAGCCCGTACACGGCGGGAGCGCCACCGGACTGGCAAGTGAGCTT
CTTCCCGGCTCCCGGGTCGTCGGAGCCTTTCAGCAGTTCGGTCCCAGCCATCTGGCACTT
GCCGGCATGGGCGTTTTCGAGACCGACGTCCCCGTCATCGGAGACGACCGCGAGGCCTGT
GACGTCGTGGAGGAACTGATCGACGAGTTCCGCGGACTTGAGCCGGTCTACGCCGGCGGA
CTGAAAACCGCCGCCGCAATCGAGGGTCTGGCGGCGTTGGTAGGAGAGGCCACCGCCGGC
ATCGGACGGCCGGTCGGATTCCGTCTCAGCTCAGGAGGCATCAAAATCCTCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [50-196]  1.2e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit