close all open/close all

CDS information : Rubra_00360


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction58,781 / 59,782 / + [in whole cluster]
58,781 / 59,782 / + [in contig]
Location58781..59782 [in whole cluster]
58781..59782 [in contig]
TypeCDS
Length1,002 bp (333 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative transcription regulator
Gene
Gene (GenBank)rubRg2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative transcription regulator]
MDLVRAKIALCDGRIDEAISLCDTGMAVADDPVLASWASIGSMVRAITAMRRGELATMIH
HANQIKEDVIFGREGLWGRDTFPWNSPAWLVVQIIEAEKGWEVAVPLARGLLTSESSARG
LLLSEPSAASFLVRILLRADDRETAERGRRCAAVLAAENPGIHAIATAALHLEALLERDI
SLLQQVAASDCDERTRSSANEDIGDLLSESAGGFRQACMHYETAMRSYADAGSPRDSSRV
RSKLRRSDAPKTAARFWPSSRISVLTDTEYAVAELVASGLTNAEVGGQMYLSRHTVAFHL
RKVFQKVGAKSRIELAVMWKQLTGQDLDVASHG
selected fasta
>putative LuxR family transcriptional regulator [putative transcription regulator]
ATGGACCTGGTCAGGGCCAAGATCGCCCTCTGTGACGGCCGCATCGACGAGGCCATCAGC
CTGTGTGACACGGGAATGGCCGTGGCGGACGACCCGGTTCTCGCGTCGTGGGCCTCGATC
GGGAGCATGGTCCGCGCGATCACCGCGATGCGCCGTGGCGAACTCGCCACGATGATTCAT
CATGCCAATCAGATCAAGGAGGACGTGATTTTCGGCCGGGAGGGGCTGTGGGGCCGGGAC
ACCTTTCCCTGGAACTCCCCCGCCTGGCTCGTCGTCCAGATCATCGAGGCGGAAAAGGGC
TGGGAGGTCGCCGTACCGCTCGCCCGCGGGCTCCTCACGTCCGAGTCGTCGGCCCGGGGC
CTTCTGCTGTCCGAGCCCTCGGCGGCGTCGTTCCTCGTGCGGATTCTGCTGCGGGCCGAC
GACCGGGAGACCGCCGAGCGTGGCCGGCGTTGCGCGGCGGTGCTCGCCGCGGAGAACCCG
GGCATTCACGCCATCGCGACCGCCGCCCTGCACCTTGAGGCGCTGCTTGAGAGGGACATC
AGCCTGCTCCAGCAGGTCGCCGCCTCCGACTGCGACGAGCGGACCCGCTCCTCGGCGAAC
GAGGACATCGGCGATCTCCTGTCCGAGAGCGCGGGAGGGTTCCGGCAGGCGTGCATGCAC
TACGAGACGGCCATGCGCTCGTACGCGGACGCGGGCTCCCCGCGCGACTCGTCCCGGGTC
CGCAGCAAGTTGCGGCGCAGCGACGCGCCCAAGACCGCGGCGAGGTTCTGGCCCAGCAGC
CGGATCTCCGTGCTGACCGACACCGAATACGCGGTGGCTGAGCTGGTGGCGAGTGGACTG
ACGAACGCCGAGGTCGGCGGCCAGATGTACCTGTCGCGTCACACCGTCGCCTTCCACCTC
CGCAAAGTCTTCCAGAAGGTCGGTGCCAAGTCGCGCATCGAACTGGCAGTCATGTGGAAG
CAGTTGACCGGTCAGGATCTGGACGTGGCCAGCCACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [258-323]  PS50043
PS50043   HTH_LUXR_2
 [265-279]  9.20000434662057e-08 PR00038 [279-295]  9.20000434662057e-08 PR00038 [295-307]  9.20000434662057e-08 PR00038
PR00038   HTHLUXR
 [262-319]  2.2999993566538e-16 SM00421
SM00421   HTH_LUXR
 [263-318]  3.3e-13 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [3-172]  3.1e-16 G3DSA:1.25.40.10 [205-271]  3.1e-16 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [272-321]  4.5e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [243-329]  2.79999889404114e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-29]  0.114 Signal
Bacteria, Gram-positive   
 [1-29]  0.095 Signal
Bacteria, Gram-negative   
TMHMM No significant hit