close all open/close all

CDS information : Rubra_00380


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction75,887 / 60,687 / - [in whole cluster]
75,887 / 60,687 / - [in contig]
Locationcomplement(60687..75887) [in whole cluster]
complement(60687..75887) [in contig]
TypeCDS
Length15,201 bp (5,066 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative polyketide synthase
Gene
Gene (GenBank)rubB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionPKS/NRPS Module

A4 methylmalonyl-CoA
5 malonyl-CoA
6 methylmalonyl-CoA
KS35..411
AT564..882
DH931..1094
KR1394..1574
ACP1679..1749
KS1776..2150
AT2306..2623
dh2670..2819
KR3097..3277
ACP3376..3450
KS3472..3833
AT3982..4302
dh4349..4494
kr4712..4914
ACP4964..5034

close this sectionSequence

selected fasta
>polyketide synthase [putative polyketide synthase]
MSTTEEDLIRALRESVKETARLKQRNSQLLAAASEPIAVVSMGCRFAGGIAGPKDFWRVV
SEGADVYTPFPTDRGWDLANLYDPDPDTPGTTYVDQGAFLHDAAEFDARFFGISPQEATA
MDPQQRQLLEVCWETIEHAGIDPDSLRGTATGVYAGIVHQDYAPDIAGAEGFLSLERALG
SAGGIASGRVAYCLGLEGPAVTVDTMCSSSLVAIHLASQALRRGECTMALAGGSTVMATP
GGFVGFARQRGLARDGRCKSFAAAADGSSWAEGVGVVLLERLSDAQRNGHQVLAVIRGSA
VNQDGASNGLTAPNGPAQQRVIRAALAAAGLTADEVDAVEAHGTGTTLGDPIEAQALLST
YGRGRDPERPLLLGSVKSVLGHTQGASGVAAVIKTVLSLRHRYLPATLHVDAPTPQVDWS
PGTVELLTEGRAWPDTGRPARSGISSFGASGTNVHMILEEVPAEPVPAGRDADGGALPFV
VTAKTATALAGLGRRLGDTVDESTALGDLAHALTTGRAVHSHRAVVVARTRDELRAGLAQ
VAEGRTGPAVISGSAGTSGPGKVVFVFPGQGTQWTGMGRQLLDTSPVFAARIAECQQAFE
PWVDWSLVDVLRGEAPETLERVDVVQPVCFAMMLGMAAVWESLGVVPDAVVGHSQGEIAA
ACVSGALSLADAARVVTLRSQAIAELLPAGGGMASLQLSQDAARTLIEPWGGRLQTAALN
GPSSVVIAGEDTALDELAAQLADSDIRFRRIPVDYASHSHYVESVRSALLADLAAVTSTA
PRTPFYSTVEPGWRDEQPFDADYWYRNLRQPVLFEPAIRELITHDHRVFIELGAHPVLLP
SISETAAELDADVLAVGSIRRDEDGPARLAASAAEVFVRGTPVNWPALLPEGAGAVRVEL
PTYPFDHQRYWITMPTTAAGAESLGQVTSGHPLLGAVVELPQTNGVVCTSRLSLATHPWL
AGHRIQDNVLVPGTAYVDLAIQVGDQLGYGVLDELVIEAPLVLAADASVSLQVAVGAPDA
TGRRRVEVHSSRADGEWTRHAAGHLQADAHDQTPGGGFDFGQWPPPGAVPEPVDDFYDSL
AERGYQYGSAFAGLTAVWRRGEEIFAEAALPADHRDDVDRFGIHPALFDAALHANAFHRR
ADDRNVLPFAWNGVRLHAGGAVALRVRVAPCGPDALSFDAADGTGAPVLSMESLVSLPIT
DVNGQPGGRTPHSLWQVDWTPLPPPAPAPATARKHQAVVETSGDVVRLALDDELGEPRPD
FAVLDVVPGAGAQTEPLPLLGRVLEVVQAWLEEPALAPVPLVVVTRGAVPASGPVADPAG
AAVWGLVRSAQAEHPDRILLVDMELDGDRDGAVTAGLASGEAQVAVRGDAVLAPRLGRAA
LTGQPAAAGFTDGGTVLITGGTGVLGALLARHLVGEHGVRRLVLAGRRGADADGMAELVA
ELGDLGACVEVAACDVTDREALTALLAAVPAEHRLTGVIHAAGVLDDAVITGLDPHRLAR
VFAPKAAALRLLDELTRDDPPEVFAVFSSAASVFGSAGQGNYAAANAYAEAIVSARAAGG
LPAVALAWGLWSPATGMTGRLADVDRTRMSRGGVRPLPPAEALAGFDAGIRAGLPLLVPI
GLDLGAVRAEAGANGTVPALFRTLVRPPRPTARAGADEPRGALSRRLAGLTSEEQTELVL
ALVRTEVTTVLGITDLDASFDDSRFGEIGFDSLTAVELRNRLTAAAAVKLPATLIFDYPT
PRQLAGHLIEKVQGSATGAAAPALHAPGHTLPASDDPVVIVGMACRLPGGITTPAEFWDL
VAEGRDGMSPLPADRGWETDRLLGTDPDQAGTTYARQGGFLHDAGYFDAGLFGISPREAT
AMDPQQRLLLETTWEALETAGVDPSSLRGEPVGVYTGMSIHDYLGDLTRVPAEFEGFTTT
ATAGSVASGRVSYVFGLEGPAMTVDTACSSSLVAIHLAAQALRQGECETALAGGVAVMGS
PVGLTGFSRARGLAADGRCKAFAAAADGTVLSEGVGVLVLERLSTARRKGHRPLAVVRGS
AINQDGASNGLTAPNSLAQQRVIRAALAASGIGPDEVDAVEAHGTGTTLGDPSEAQALIA
TYGHGRPAQRPLWLGSVKSNLGHTQAAAGVTAVIKMVEAIRHGHLPPTLFVDEPTPHVDW
SEGAVRLLTEGRPWPDADRPRRAGISSFGISGTNAHLILEQIPEPAAPEEDGDNAPAVLP
FVLSAQSATALAGQAAQLRTAVEQGVPLSGTARTLLAGRALLAHRAVVAAADRDALLAGL
DTVAAGEAGPGTAVGAAFAGAGASVVFVFPGQGAQRPGMGRALYDRFPVYAAAFDDACAR
LDERLAGAADRSVRDVVFARPDSPEAAALDQTVYTQAALFAVETALFRLVESWGVRPALL
LGHSVGEIAAAHAAGLLSLDDAATVVAARGRLMQALPAGGAMAAVAATEEELRPFLTEGV
SLAAVNDPASAVLSGDEDAVDAAVRTLREQGRKVHRLPVSHAFHSARMDPMLAEFRTAIA
DVVWRPARIAVVAHDGADLTDPDHWVDHVRRTVPLPDGVRTALDRGGRLFVELGPGAGLS
APILETAARSGYEPVCVSALRDGQAEPDTMISSMAALFVRGVPMDWHPLVPADAPDVLLP
TYAFDRRHYWLPPAPGAANAADLGQSRVEHPLLSAIVPVPDTGGLIGTARLALTTHPWLA
AHRLHEVETLPAAALVDLAVRVGDELGYGVLGNLTLETPLTIPAETTVRLEIVVGADDGG
SAPFTVYGARDSEENWVRHAGGTLEAGAVTDPGPVQPWPPSGAEQVTSGPETPERSRLLG
LWRRGEDTFVEVALADEEEPDTFGLDPALLDAVTRAVLDPASAATRWESVVLHATGARRL
RAHLTRLDHDRWSLRATDETGRAVLSARSVHSTPVRPEDVGARPPQAMYRLMWHPVATPA
VPPGHPAAVSVTSAEDVAALAAGPGRPTAAVYDVPTGTSHPAAVLADVLGLLQAWQRHAP
ADTRLVVRTEGAVDGGTGGLTDATGAAVWGLTRAAQAEMPGVLLLDVEPGLDTAPALATA
LAVDEPQLAARTDGFRVPRLAAAGAPAAEPASWNPDGTVLITGGTGSLGALVALHLVRTR
GVRRLLLASRRGAAADGTEALVAELSAQGAETSVISCDVADRDAVAAMLAAIPPEHPLTA
VVHTAGVLDDGLVAAMTPARLDAVFGPKADAARHLEELTRDHDLAAFVTFSSAAGLLGSA
GQANYAAANAYLDGLMAIRRANGRNGVSLSWGLWAQDSGITLHLTDADRARMRRAGVSPL
RPEEGLMLFDAAVDSGEAHLVPIKLDLAAARAEAATGEPVQRLLRRSGTRPPPGGPRRRA
PVTLAGSLANRSVAEQERSLLSLVRARAALILGYASAEDIAPDAPFQSAGMDSLGAIELR
NRLSAAAGFAMPASLIFDYPTPVELARFLRERLTDADTPAAAGAAVAASPADPIAVVGIG
CRLPGGVRGPDGLWDLLTARGEGRSAVPTDRGWDLSTIPVEAGGFLTDAAEFDAGFFGIS
PREATAMDPQQRLLLEVVWEAFEDAGLDPAAHRGSDVGVFVGVMGEGYGMNGGDPQTDGL
RVTGGALSVASGRVSYTYGFTGPAISVDTACSSSLVAMHLAMQALRNGECSLAVVGGVTV
MATPNAYLEFAKAGGLAADGRCKAYSASADGTSWSEGVGVVLLQRLPDAEAQGSTVGAVI
RGSAVNQDGASNGLTAPNGLAQQRVIQRALAAAGLAPSDVDVVEGHGTGTRLGDPIEAQA
LQATYGRRGTAQPLWLGSVKSNIGHTQAAAGVAGVIKMVLALRHQTPPTTSEVDWSGDTV
RLLTVARPWPARPDRPRRAGVSAFGASGTNAHVILEEPPRRGTASGPAESGGGGILPFTV
SAGDPGRLAAAATRLADTVENRRPPLPDLAAALAFGRTKHRERATVLAADHAELARRLRS
LAAGETEPDVITGRAGPGTGAVFVFPGQGGGWAGMGRELMAESAEFREWVHRCQELLDTY
DCDWTLEEALGGADDLSRTDVVQPAAFVMMTGLAQLWARAGVTPDVVIGSSQGELAAACV
AGLLSLDDALRICVVRSRLAAALPPTGGMLVLGVGRTRAQELLSAYGGRLELAAVNGPAM
VGVSGEADAIEHLAAFAAEQEIWFRRLRADYASHSFLVDELERPMLAQLDGVGERPAHGL
VGSCRFYSTVESRWIGPDEVLDAGYWFRNLRRPVELEGAVREVTTEMRAVIEVSPHPGLV
SSILDVIADTGRPVGVIGTLRRDQGGPRQVLTALAEAFAIGLPVDWSAVVPGDGPAWREL
CRDLPTHPFDHRRYWLRGGTVAAADEAAHPLLTTVAALPGSGGVLAAGRLSANHPWLTGA
VPASTWIELVIRAGDEVDCGTVAELDLVEPLRLDRSDARQVQVVVARADLTGRRPVQVRT
GSDRSGWTLNATGVLSPGPAAAAPAETGTGPLSWPPAGADPVTPAGLPDCVRGVWRRGEE
TFLEVILPNELREEADGFGIHPLLLDAATRATGEATSWREVELHATGAVSVRVALRPAED
GIALTAVDSDDDLLDPTALAAAVAVLDVLPGEPPAAACRRALAVTQAWLDEPELAGHRLV
VRTRNAVSAEPVAVLDPAAAAVRGMIAAIQAEYPDRFVLVDVEPGADPDAGLGPVLAADA
AQAAVRAGRVHVPRLVAVNEAGPAVRPLDPDSTVLIVGGTDGTGSRVARHLAADHGVRHL
VLADPQGADTPRSAALADELAALSASVSVVACDVTDRDALHRLLSAIPADHPLTGVVHAA
ETADRTPLGELDPERLDAVLGARSDSLRHLAELAAGRELALFAVVTTAAELTGPADQAAT
AAADGLARAAAASCGARVPVLASADGPGLSALSAAIGTAEQFPVPGRPDQWGAPVPGRPV
PPLLRGLVRPRRRPAYRAAAGAERADRWSQLLSAQAGADREKTVLDLVQAQLVGVLGLDP
EEPVEPERGFFESGLDSVMAIELARRLNSHAGTALTPAGVFNHPTPAALTRHLVELIETA
GRRVPVAVPHRSHRSQAGGSGPRTVR
selected fasta
>polyketide synthase [putative polyketide synthase]
GTGAGTACCACTGAGGAAGATCTCATCCGGGCATTGCGCGAGTCGGTCAAGGAAACGGCC
AGGCTGAAGCAGCGGAACAGCCAGCTGCTCGCCGCGGCCTCGGAGCCGATAGCGGTGGTC
TCCATGGGATGCCGCTTCGCCGGGGGCATCGCCGGGCCGAAGGACTTCTGGCGTGTGGTG
TCTGAAGGCGCCGACGTCTACACACCGTTCCCCACCGACCGCGGCTGGGACCTGGCCAAC
CTCTACGACCCGGACCCGGACACACCCGGTACGACCTACGTCGACCAGGGCGCGTTCCTG
CACGACGCCGCCGAGTTCGACGCCCGCTTCTTCGGCATCTCACCCCAAGAGGCGACAGCG
ATGGACCCGCAGCAGCGGCAGCTTCTCGAGGTCTGCTGGGAGACGATCGAACACGCCGGA
ATCGACCCGGACAGCCTGCGCGGCACCGCCACCGGCGTCTACGCGGGCATCGTGCACCAG
GACTACGCACCCGACATCGCGGGCGCGGAGGGCTTCCTCAGCCTCGAGCGCGCGCTGGGC
AGCGCCGGCGGCATCGCCTCCGGCCGGGTCGCCTACTGCCTCGGGCTGGAGGGGCCCGCG
GTCACGGTCGACACGATGTGCTCGTCGTCGCTGGTCGCGATCCACCTGGCGAGCCAGGCA
CTGCGCCGGGGCGAGTGCACGATGGCACTCGCCGGCGGCTCGACCGTGATGGCGACACCG
GGCGGCTTCGTCGGATTCGCCCGCCAGCGGGGCCTCGCCCGCGACGGCCGGTGCAAGTCC
TTCGCCGCCGCGGCGGACGGCAGCAGCTGGGCCGAGGGCGTCGGCGTGGTACTGCTCGAG
CGCCTCTCGGACGCCCAGCGCAACGGGCATCAGGTACTCGCCGTGATCCGCGGCTCCGCG
GTCAACCAGGACGGCGCCTCCAACGGCCTCACCGCCCCCAACGGGCCCGCCCAGCAGCGG
GTCATCCGCGCCGCGCTTGCCGCCGCCGGGCTGACCGCCGACGAGGTCGACGCCGTCGAG
GCGCACGGCACGGGAACCACGCTCGGCGACCCGATCGAAGCGCAGGCGCTGCTGTCGACG
TACGGCCGGGGACGCGACCCCGAGCGGCCCCTGCTCCTCGGCTCGGTCAAGTCGGTCCTC
GGCCACACCCAGGGCGCCTCGGGCGTCGCGGCGGTGATCAAGACCGTGCTGTCGCTGCGT
CACCGGTACCTGCCCGCCACACTGCACGTCGACGCCCCGACCCCGCAGGTCGACTGGTCA
CCCGGCACGGTCGAACTGCTGACCGAGGGACGCGCGTGGCCCGACACCGGGCGCCCGGCC
CGCTCCGGCATCTCCTCCTTCGGCGCCAGCGGAACCAACGTCCACATGATCCTCGAGGAG
GTTCCGGCCGAGCCCGTCCCGGCCGGCCGGGACGCCGACGGCGGGGCACTGCCGTTCGTC
GTCACCGCCAAGACCGCCACCGCGCTGGCCGGCCTCGGCCGACGGCTCGGGGACACCGTG
GACGAGAGCACCGCCCTCGGCGACCTCGCCCACGCGCTGACGACCGGACGCGCGGTGCAC
AGCCACCGGGCGGTGGTGGTGGCCCGGACCCGGGACGAGCTGCGCGCGGGGCTCGCCCAG
GTGGCCGAGGGCCGCACCGGGCCCGCAGTGATCAGCGGGTCGGCCGGCACGAGCGGCCCC
GGCAAGGTCGTCTTCGTCTTCCCCGGCCAGGGCACCCAGTGGACCGGCATGGGCCGTCAG
CTGCTGGACACCTCGCCGGTCTTCGCCGCCCGGATCGCCGAGTGCCAGCAGGCGTTCGAG
CCCTGGGTCGACTGGTCCCTGGTCGACGTCCTGCGCGGCGAGGCTCCCGAGACGCTCGAA
CGTGTCGACGTCGTACAGCCGGTGTGCTTCGCGATGATGCTCGGCATGGCGGCGGTCTGG
GAATCGCTCGGCGTGGTCCCGGACGCGGTCGTCGGCCACTCGCAGGGCGAGATCGCCGCC
GCCTGCGTCTCGGGCGCGCTCTCCCTGGCCGACGCCGCCCGAGTGGTGACACTGCGCAGC
CAGGCGATCGCCGAGCTGCTGCCCGCCGGGGGCGGAATGGCATCGCTCCAACTGTCCCAG
GACGCGGCACGCACCCTGATCGAGCCGTGGGGAGGGCGCCTGCAGACGGCGGCGCTCAAC
GGCCCCTCGTCCGTGGTGATCGCCGGCGAGGACACCGCGCTGGACGAGCTCGCGGCGCAA
CTGGCGGACAGCGACATCCGCTTCCGCCGGATTCCGGTCGACTACGCCTCACACAGCCAC
TACGTGGAGAGTGTGCGATCCGCCCTGCTGGCCGACCTCGCCGCCGTCACCTCCACGGCA
CCGCGCACACCGTTCTACTCGACGGTCGAGCCCGGCTGGCGCGACGAACAGCCCTTCGAC
GCCGACTACTGGTACCGCAACCTGCGCCAGCCCGTCCTGTTCGAACCGGCCATCCGCGAG
CTGATCACCCACGACCACCGGGTCTTCATCGAGCTCGGCGCCCACCCGGTGCTGCTCCCG
TCGATCAGCGAGACCGCGGCCGAGCTGGACGCGGACGTGCTCGCGGTCGGATCGATCCGG
CGGGACGAGGACGGACCGGCCCGGCTGGCCGCCTCGGCGGCCGAGGTCTTCGTCCGCGGC
ACGCCGGTGAACTGGCCGGCCCTGCTGCCCGAGGGCGCCGGAGCGGTACGGGTCGAACTG
CCCACCTACCCCTTCGACCACCAGCGCTACTGGATCACCATGCCGACCACGGCGGCGGGC
GCCGAGTCGCTGGGCCAGGTGACCAGCGGCCACCCGCTGCTCGGCGCAGTGGTGGAACTC
CCGCAGACCAACGGCGTGGTCTGCACCTCCCGGCTGTCCCTGGCGACCCACCCCTGGCTG
GCCGGCCACCGCATCCAGGACAACGTACTGGTGCCCGGCACCGCCTACGTCGACCTGGCG
ATCCAGGTCGGCGACCAGCTCGGCTACGGGGTGCTCGACGAACTGGTGATCGAGGCGCCG
CTGGTGCTCGCCGCGGACGCGTCCGTCAGCCTGCAAGTCGCCGTCGGCGCACCGGACGCC
ACCGGCCGCCGGCGGGTGGAGGTGCACAGCTCCCGCGCCGACGGCGAATGGACCCGGCAC
GCCGCCGGCCACCTGCAGGCCGACGCGCACGACCAGACGCCGGGCGGCGGCTTCGACTTC
GGCCAGTGGCCGCCCCCGGGCGCCGTTCCCGAGCCGGTCGACGACTTCTACGACAGCCTC
GCCGAACGCGGGTACCAGTACGGGTCGGCCTTCGCCGGGCTGACCGCCGTGTGGCGGCGC
GGTGAGGAGATCTTCGCCGAGGCCGCGCTGCCCGCCGACCACCGGGACGACGTGGACCGG
TTCGGCATCCACCCCGCGCTCTTCGACGCCGCCCTGCACGCGAACGCCTTCCACCGGCGC
GCGGACGACCGTAACGTCCTGCCGTTCGCCTGGAACGGCGTCCGGCTGCACGCCGGCGGG
GCCGTCGCGCTGCGCGTCCGCGTCGCGCCGTGCGGACCGGACGCGCTGTCCTTCGACGCC
GCGGACGGCACCGGCGCGCCGGTGCTGTCCATGGAATCACTGGTCTCCCTCCCGATCACG
GACGTGAACGGGCAGCCGGGCGGCCGGACGCCGCACTCGCTCTGGCAGGTCGACTGGACG
CCGCTGCCCCCGCCGGCGCCGGCGCCGGCCACGGCGCGAAAGCACCAGGCCGTCGTCGAG
ACCTCGGGCGACGTGGTCCGGCTGGCGCTGGACGACGAACTCGGCGAGCCCCGCCCGGAC
TTCGCCGTCCTGGACGTCGTACCCGGCGCCGGCGCGCAGACCGAGCCGCTGCCGCTGCTG
GGCCGGGTGCTCGAGGTGGTGCAGGCATGGCTGGAGGAACCGGCGCTCGCCCCGGTGCCC
CTGGTGGTGGTGACCCGCGGCGCGGTTCCGGCGTCGGGCCCCGTCGCGGACCCGGCGGGT
GCCGCGGTCTGGGGGCTGGTGCGGTCGGCACAGGCCGAGCACCCGGACCGGATCCTCCTG
GTCGACATGGAGTTGGACGGGGACCGCGACGGGGCGGTCACCGCGGGCCTCGCCAGCGGC
GAGGCCCAGGTCGCGGTCCGCGGGGACGCCGTCCTGGCCCCGCGCCTGGGCCGTGCCGCC
CTCACCGGGCAACCGGCCGCGGCCGGCTTCACCGACGGCGGCACCGTACTGATCACCGGC
GGGACCGGCGTGCTCGGCGCGCTGCTGGCCCGGCATCTGGTGGGCGAGCACGGCGTACGC
CGGCTGGTCCTGGCGGGCCGGCGCGGCGCGGACGCCGACGGGATGGCCGAGTTGGTGGCC
GAACTGGGTGACCTGGGTGCGTGCGTCGAGGTGGCCGCCTGCGACGTGACCGACCGGGAG
GCGCTCACCGCGCTGCTCGCCGCCGTCCCGGCCGAGCACCGGCTGACCGGCGTCATCCAC
GCGGCCGGGGTGCTGGACGACGCCGTCATCACCGGCCTCGACCCGCACCGCCTGGCCCGG
GTGTTCGCACCGAAGGCGGCGGCACTGCGGCTGCTGGACGAACTGACCCGCGACGACCCG
CCCGAGGTCTTCGCCGTGTTCTCCTCGGCCGCGAGCGTTTTCGGCTCGGCAGGCCAGGGC
AACTACGCGGCCGCGAACGCCTACGCCGAGGCGATCGTGTCCGCACGCGCCGCCGGCGGT
CTGCCCGCGGTGGCACTGGCCTGGGGACTGTGGAGCCCGGCGACCGGAATGACCGGCCGG
CTGGCCGACGTCGACCGGACCCGGATGAGCCGTGGCGGCGTACGTCCGCTACCGCCCGCC
GAAGCGCTGGCCGGCTTCGACGCCGGCATCCGCGCCGGCCTCCCGCTGCTGGTGCCGATC
GGTCTCGACCTCGGCGCGGTCCGGGCCGAGGCGGGAGCCAACGGCACCGTTCCGGCTCTC
TTCCGCACGCTGGTCCGGCCGCCACGGCCCACCGCGCGGGCGGGCGCCGACGAGCCCAGG
GGCGCACTGAGCCGCCGGCTCGCCGGGCTCACCAGCGAGGAGCAGACCGAACTGGTCCTC
GCGCTCGTGCGTACAGAGGTCACGACCGTGCTCGGCATCACCGACCTCGATGCCTCCTTC
GACGACAGCCGCTTCGGCGAGATCGGGTTCGACTCACTGACCGCGGTCGAACTGCGCAAC
CGGCTGACCGCGGCGGCCGCGGTCAAGCTCCCCGCCACGCTGATCTTCGACTACCCGACA
CCACGGCAGCTGGCCGGCCACCTGATCGAGAAGGTGCAGGGGTCCGCCACCGGCGCCGCC
GCGCCCGCGCTCCACGCCCCCGGACACACGCTCCCGGCGTCCGACGACCCCGTGGTGATC
GTCGGCATGGCGTGCCGCCTGCCGGGCGGGATCACCACACCGGCCGAGTTCTGGGACCTG
GTGGCCGAAGGACGGGACGGCATGTCCCCGCTGCCGGCCGACCGCGGCTGGGAGACGGAC
CGCCTCCTTGGCACCGACCCCGACCAGGCCGGCACCACCTACGCCCGACAGGGCGGCTTC
CTGCACGACGCCGGCTACTTCGACGCCGGGCTGTTCGGCATCTCGCCGCGTGAGGCGACC
GCCATGGATCCCCAGCAACGGCTGCTCCTCGAAACCACCTGGGAGGCCCTGGAGACGGCC
GGCGTCGACCCCTCGTCGCTGCGCGGCGAACCCGTCGGCGTCTACACCGGCATGTCCATC
CACGACTACCTCGGCGACCTGACGCGCGTACCGGCTGAGTTCGAGGGCTTCACCACCACG
GCGACGGCCGGCAGCGTCGCCTCCGGCCGCGTGTCGTACGTGTTCGGTCTCGAGGGCCCG
GCCATGACGGTCGACACCGCGTGCTCGTCCTCCCTGGTGGCGATCCACCTGGCGGCCCAG
GCACTGCGCCAGGGCGAGTGCGAGACGGCACTCGCCGGTGGCGTGGCCGTCATGGGCTCC
CCCGTCGGCCTGACCGGGTTCTCGCGGGCACGCGGACTCGCCGCCGACGGCCGGTGCAAG
GCGTTCGCCGCGGCGGCCGACGGCACCGTGCTCTCCGAGGGCGTCGGCGTCCTGGTGCTG
GAACGGCTGTCCACCGCACGGCGCAAGGGACATCGCCCGCTCGCCGTCGTCCGCGGTTCC
GCGATCAACCAGGACGGCGCGTCCAACGGCCTCACCGCCCCCAACAGCCTGGCCCAGCAG
CGGGTCATCCGGGCCGCTCTCGCCGCCTCGGGCATCGGCCCGGACGAGGTCGACGCGGTG
GAGGCACACGGCACCGGCACCACGCTCGGCGACCCCAGCGAGGCACAGGCCCTCATCGCG
ACCTACGGCCACGGCCGTCCGGCCCAGCGACCGCTGTGGCTCGGCTCGGTGAAGTCCAAC
CTCGGCCACACACAGGCGGCGGCCGGTGTCACGGCGGTGATCAAGATGGTGGAGGCGATC
CGGCACGGGCATCTGCCGCCCACGCTCTTCGTCGACGAACCCACCCCCCACGTCGACTGG
TCCGAGGGCGCCGTGAGGCTGCTGACCGAGGGCCGGCCCTGGCCCGACGCCGACCGGCCG
CGGCGCGCCGGAATCTCGTCGTTCGGCATCAGCGGCACCAACGCCCACCTGATCCTGGAA
CAGATCCCCGAACCGGCCGCGCCGGAGGAGGACGGGGACAACGCGCCGGCCGTGCTGCCG
TTCGTGCTGTCCGCACAGAGCGCGACGGCACTCGCCGGCCAGGCCGCACAGCTGCGCACC
GCCGTCGAGCAGGGGGTGCCGCTTTCCGGTACGGCCCGCACCCTCCTCGCCGGCCGCGCG
CTGCTCGCGCACCGGGCGGTCGTCGCCGCGGCCGACCGGGACGCTCTGCTCGCCGGCCTG
GACACGGTCGCCGCGGGCGAGGCCGGTCCCGGCACGGCAGTGGGCGCCGCCTTTGCCGGC
GCCGGGGCATCCGTGGTGTTCGTCTTCCCCGGCCAGGGGGCGCAGCGGCCCGGAATGGGC
CGCGCCCTCTACGACCGGTTCCCGGTCTACGCCGCCGCCTTCGACGACGCGTGCGCCAGG
CTCGACGAGCGGCTGGCCGGCGCCGCGGACCGGTCCGTCCGGGACGTGGTCTTCGCCCGG
CCGGACAGCCCGGAGGCGGCCGCGCTGGACCAGACCGTCTACACCCAGGCGGCGCTGTTC
GCCGTCGAGACCGCACTGTTCCGGCTCGTCGAGTCCTGGGGCGTACGGCCTGCCCTGCTG
CTCGGGCACTCGGTGGGCGAGATCGCCGCGGCGCACGCCGCCGGCCTGCTGTCGCTCGAC
GACGCGGCGACCGTGGTGGCCGCCCGCGGCCGCCTCATGCAGGCCCTGCCCGCCGGGGGA
GCGATGGCCGCGGTGGCCGCGACGGAGGAGGAGCTCCGGCCGTTCCTCACCGAGGGCGTC
TCCCTCGCCGCGGTGAACGACCCCGCCTCGGCCGTGCTGTCCGGTGACGAGGACGCGGTG
GACGCCGCCGTGCGGACACTGCGGGAACAGGGCCGCAAGGTGCACCGGCTGCCGGTGTCC
CACGCCTTCCACTCGGCGCGGATGGACCCGATGCTCGCCGAGTTCCGGACCGCGATCGCG
GACGTGGTCTGGCGTCCGGCCCGGATTGCGGTGGTCGCCCACGACGGAGCCGACCTCACC
GACCCCGACCACTGGGTCGACCACGTCCGGCGCACCGTGCCGTTGCCCGACGGCGTGCGC
ACCGCACTGGACCGGGGCGGGCGGCTGTTCGTCGAACTGGGGCCGGGGGCCGGCCTGTCC
GCGCCGATCCTGGAGACGGCGGCACGGTCCGGGTACGAACCGGTGTGCGTTTCCGCGCTG
CGGGACGGACAGGCCGAACCCGACACCATGATCAGCTCGATGGCCGCGCTGTTCGTGCGG
GGAGTGCCGATGGACTGGCATCCGCTCGTCCCCGCGGACGCCCCGGATGTGCTGCTGCCG
ACGTACGCGTTCGACCGACGGCACTACTGGCTGCCCCCGGCGCCCGGTGCGGCGAACGCG
GCCGACCTGGGCCAGAGCCGGGTCGAGCACCCGCTGCTGTCGGCGATCGTGCCCGTCCCG
GACACCGGCGGCCTGATCGGCACGGCCCGGCTGGCGCTCACGACCCACCCCTGGCTCGCC
GCGCACAGGCTGCACGAGGTGGAGACCCTGCCGGCCGCCGCACTCGTCGACCTCGCCGTG
CGGGTGGGCGACGAACTCGGTTACGGCGTACTGGGAAACCTGACGCTGGAGACCCCGCTG
ACGATCCCCGCGGAGACGACCGTCCGGCTGGAGATCGTGGTCGGAGCCGACGACGGCGGC
AGCGCCCCGTTCACGGTCTACGGCGCCCGCGACAGTGAGGAGAACTGGGTCCGGCATGCC
GGCGGCACGCTGGAAGCAGGCGCCGTCACCGACCCCGGGCCGGTGCAGCCGTGGCCGCCG
TCCGGCGCCGAGCAGGTCACGAGCGGCCCGGAGACCCCCGAACGCTCGCGGCTGCTCGGG
CTGTGGCGCCGCGGCGAGGACACCTTCGTGGAGGTCGCGCTCGCCGACGAGGAGGAGCCC
GATACGTTCGGACTCGACCCGGCCCTGCTCGACGCAGTGACCCGGGCGGTCCTCGACCCC
GCCTCGGCCGCGACACGATGGGAGTCGGTGGTACTGCACGCCACCGGGGCGCGCCGACTG
CGGGCTCACCTCACCCGGCTGGACCACGACCGCTGGAGCCTTCGGGCGACCGACGAAACC
GGCAGGGCGGTCCTGTCCGCCCGCTCGGTCCACTCGACGCCGGTCCGCCCCGAGGACGTG
GGCGCCCGCCCCCCGCAGGCCATGTACCGCCTGATGTGGCACCCCGTGGCCACCCCGGCG
GTTCCGCCCGGCCACCCGGCGGCCGTCAGCGTCACCAGCGCCGAGGACGTGGCCGCGCTC
GCCGCCGGACCCGGCCGGCCGACGGCCGCCGTGTACGACGTACCGACCGGCACCTCCCAC
CCGGCGGCCGTCCTCGCCGACGTTCTCGGCCTGCTCCAGGCCTGGCAGCGCCACGCCCCC
GCGGACACCCGGCTGGTCGTGCGGACCGAGGGCGCCGTCGACGGCGGGACCGGCGGCCTG
ACCGACGCGACCGGTGCCGCCGTGTGGGGCCTGACCCGTGCGGCCCAGGCCGAGATGCCC
GGTGTCCTGCTGCTCGACGTGGAGCCGGGCCTCGATACGGCACCGGCCCTCGCCACGGCA
CTGGCCGTCGACGAACCACAGCTCGCCGCCAGGACCGACGGTTTTAGGGTTCCCCGCCTC
GCGGCGGCCGGTGCACCGGCCGCCGAGCCCGCCTCGTGGAACCCGGACGGGACGGTGCTG
ATCACCGGTGGCACCGGGTCGCTCGGCGCTCTCGTCGCGCTCCACCTGGTGCGCACCCGC
GGTGTCCGGCGGTTGCTCCTGGCCAGCAGGCGCGGAGCTGCCGCCGACGGCACCGAGGCA
CTGGTGGCCGAGCTGTCCGCACAGGGCGCCGAGACGTCCGTGATCAGCTGCGACGTCGCG
GACCGGGACGCGGTGGCGGCGATGCTCGCCGCGATCCCGCCGGAGCACCCGCTGACCGCG
GTCGTGCACACCGCCGGCGTCCTGGACGACGGGCTGGTCGCCGCGATGACCCCGGCACGC
CTGGACGCCGTGTTCGGCCCGAAGGCGGACGCCGCCCGCCACCTGGAGGAGCTGACCCGC
GACCACGACCTCGCCGCGTTCGTCACGTTCTCGTCCGCCGCCGGACTGCTCGGCTCGGCC
GGCCAGGCCAACTACGCCGCCGCCAACGCCTACCTGGACGGCCTCATGGCGATCCGGCGC
GCCAACGGCCGCAACGGCGTGTCACTGTCCTGGGGCCTGTGGGCCCAGGACAGCGGCATC
ACGCTCCACCTCACCGACGCGGACCGGGCCCGGATGCGCCGCGCCGGCGTGTCGCCACTG
CGCCCCGAGGAAGGGCTCATGCTCTTCGACGCGGCCGTGGACAGCGGTGAGGCCCACCTC
GTACCGATCAAGCTCGACCTCGCCGCCGCGCGGGCCGAAGCGGCCACCGGCGAACCGGTC
CAGCGGCTGCTGCGGCGATCTGGTACGCGTCCGCCGCCGGGCGGGCCCAGGCGGCGGGCG
CCGGTGACCCTGGCGGGCTCGCTGGCCAACCGGTCGGTGGCGGAGCAGGAGCGCTCCCTG
CTGTCCCTGGTCCGGGCCAGGGCGGCGCTGATCCTGGGATACGCCTCGGCCGAGGACATC
GCACCGGACGCGCCGTTCCAGTCCGCCGGGATGGACTCGCTGGGCGCGATCGAGCTGCGC
AACCGGCTCAGCGCCGCGGCCGGCTTCGCCATGCCCGCGTCGTTGATCTTCGACTACCCC
ACGCCGGTGGAACTGGCCCGGTTCCTGCGGGAGCGGCTCACCGACGCAGACACGCCCGCC
GCGGCCGGCGCCGCCGTGGCGGCGAGCCCGGCCGATCCGATCGCGGTGGTCGGGATCGGC
TGCCGGCTGCCGGGCGGCGTGCGGGGCCCGGACGGGCTCTGGGACCTGCTGACCGCACGC
GGCGAGGGCCGGTCGGCGGTGCCGACCGACCGCGGCTGGGACCTGTCCACCATCCCGGTG
GAGGCGGGCGGCTTCCTGACGGACGCGGCCGAGTTCGACGCCGGCTTCTTCGGCATCTCC
CCACGCGAGGCGACGGCCATGGACCCCCAGCAGCGGCTGCTGCTCGAGGTCGTGTGGGAG
GCATTCGAGGACGCGGGGCTCGACCCGGCCGCCCATCGAGGTTCCGACGTCGGCGTCTTC
GTAGGCGTGATGGGCGAGGGCTACGGGATGAACGGCGGTGATCCGCAGACCGACGGCCTG
CGGGTCACCGGCGGCGCCCTCTCGGTGGCGTCCGGCCGCGTGTCCTACACGTACGGCTTC
ACCGGGCCGGCGATCTCGGTCGACACGGCGTGCTCCTCCTCCCTCGTCGCGATGCATCTG
GCCATGCAGGCCCTGCGCAACGGCGAGTGCTCGCTCGCCGTGGTCGGCGGTGTGACGGTC
ATGGCGACGCCCAACGCGTACCTCGAGTTCGCCAAGGCCGGCGGGCTCGCGGCCGACGGG
CGGTGCAAGGCCTACTCCGCGTCGGCGGACGGGACCAGCTGGTCGGAGGGCGTCGGCGTG
GTGCTGCTGCAGCGACTGCCGGACGCCGAGGCCCAGGGCAGCACGGTGGGCGCCGTGATC
CGGGGCTCGGCGGTCAACCAGGACGGCGCCTCGAACGGCCTGACCGCCCCGAACGGGCTC
GCGCAGCAGCGGGTCATCCAGCGGGCCCTCGCGGCCGCCGGGCTCGCGCCGTCCGACGTG
GACGTCGTCGAGGGACACGGCACGGGCACCCGGCTGGGCGACCCGATCGAGGCGCAAGCA
CTCCAGGCCACCTACGGAAGGCGCGGGACGGCGCAGCCGCTGTGGCTGGGGTCGGTGAAG
AGCAACATCGGCCACACCCAAGCGGCGGCCGGTGTGGCGGGCGTGATCAAGATGGTGCTG
GCGTTGCGCCACCAGACGCCGCCGACGACGTCCGAGGTCGACTGGTCCGGTGACACCGTC
CGGCTGCTGACCGTGGCCAGGCCGTGGCCGGCCCGCCCGGACCGGCCACGCCGCGCCGGA
GTGTCCGCTTTCGGGGCCAGCGGCACCAACGCACACGTCATCCTCGAAGAGCCGCCCCGG
CGGGGCACCGCGAGCGGACCGGCCGAGTCCGGCGGGGGAGGCATCCTGCCGTTCACCGTG
TCGGCGGGCGACCCAGGCCGGCTCGCCGCGGCCGCGACCCGGCTGGCCGACACCGTGGAG
AACCGGCGGCCACCGCTGCCCGACCTGGCCGCCGCGCTCGCGTTCGGCCGGACGAAGCAC
CGGGAACGGGCCACCGTACTCGCGGCCGACCACGCCGAACTGGCCCGGCGGCTGCGGAGC
CTGGCCGCCGGCGAGACCGAGCCGGACGTCATCACCGGACGGGCCGGGCCGGGCACCGGC
GCGGTGTTCGTCTTCCCCGGCCAGGGCGGCGGATGGGCCGGCATGGGCCGTGAACTGATG
GCCGAGTCGGCGGAGTTCCGGGAATGGGTGCACCGGTGCCAGGAACTGCTCGACACCTAC
GACTGCGACTGGACACTGGAGGAAGCGCTCGGCGGCGCCGACGACCTCTCCCGGACCGAC
GTGGTCCAGCCCGCCGCGTTCGTGATGATGACCGGGCTGGCGCAGCTGTGGGCCAGGGCC
GGTGTCACGCCCGACGTGGTGATCGGGTCGTCGCAAGGTGAGCTCGCCGCGGCATGCGTG
GCCGGGCTCCTCTCGCTGGACGACGCGCTGCGGATCTGCGTGGTGCGCTCCCGGCTGGCC
GCGGCACTGCCACCCACCGGCGGAATGCTCGTCCTGGGCGTCGGCCGCACGCGGGCGCAG
GAGCTGCTGTCGGCGTACGGGGGCAGGCTCGAACTGGCCGCGGTCAACGGACCCGCGATG
GTCGGCGTCTCCGGTGAGGCCGACGCCATCGAGCACCTCGCGGCCTTCGCCGCCGAGCAG
GAGATCTGGTTCCGCAGACTGCGGGCGGACTACGCCTCCCACTCCTTCCTCGTGGACGAG
CTGGAACGCCCGATGCTGGCCCAGCTCGACGGCGTCGGCGAGCGCCCCGCACACGGACTC
GTCGGCTCGTGCCGGTTCTACTCCACGGTCGAGAGCCGGTGGATCGGCCCGGACGAGGTA
CTCGACGCGGGCTACTGGTTCCGCAACCTGCGCCGGCCGGTCGAGCTGGAAGGGGCCGTC
CGCGAGGTGACCACCGAGATGCGGGCCGTCATCGAGGTGTCCCCGCATCCGGGCCTGGTC
TCGTCGATCCTCGACGTCATCGCCGACACCGGCCGGCCGGTCGGGGTGATCGGCACGCTC
CGCCGTGACCAGGGCGGCCCGCGCCAGGTGCTGACCGCGCTGGCCGAGGCGTTCGCGATC
GGGCTGCCGGTCGACTGGTCGGCGGTTGTCCCCGGCGACGGGCCGGCCTGGCGTGAGCTC
TGCCGCGACCTGCCCACCCATCCCTTCGACCATCGCCGGTACTGGCTGCGTGGCGGCACC
GTCGCGGCCGCGGACGAAGCGGCCCACCCGCTGCTGACCACCGTGGCGGCACTGCCCGGT
TCCGGCGGCGTGCTGGCCGCCGGCCGGCTGTCCGCGAACCACCCGTGGCTCACCGGAGCG
GTTCCCGCTTCGACGTGGATCGAGCTGGTCATCCGGGCCGGTGACGAGGTGGACTGCGGC
ACGGTGGCAGAACTCGATCTGGTCGAACCCCTCCGGCTGGACCGGAGCGATGCGCGGCAG
GTCCAGGTCGTGGTCGCCCGCGCGGACCTCACCGGCCGGCGCCCGGTGCAGGTGCGGACC
GGCAGTGACCGGTCGGGCTGGACCCTGAACGCGACCGGTGTCCTCTCGCCCGGCCCCGCG
GCAGCAGCCCCAGCGGAAACCGGAACCGGCCCGCTGTCCTGGCCGCCGGCCGGCGCCGAC
CCGGTGACACCCGCCGGCCTGCCCGACTGCGTACGCGGCGTCTGGCGGCGAGGCGAGGAG
ACCTTCCTGGAAGTGATCCTGCCAAACGAGCTCCGCGAGGAGGCCGACGGCTTCGGCATC
CACCCGCTGCTCCTGGACGCCGCGACCCGTGCCACGGGCGAGGCGACCTCATGGCGCGAA
GTCGAACTGCACGCGACCGGCGCCGTGTCCGTGCGGGTCGCGCTGCGCCCGGCTGAGGAC
GGCATCGCACTGACCGCGGTCGACAGCGACGACGACCTGCTCGATCCCACCGCTCTGGCC
GCGGCGGTCGCGGTGCTCGATGTGCTGCCTGGCGAGCCGCCCGCGGCGGCCTGCCGCCGA
GCGCTCGCCGTCACACAGGCGTGGCTGGACGAGCCCGAACTGGCCGGCCACCGGCTGGTG
GTACGGACCCGGAACGCGGTTTCGGCCGAGCCCGTCGCGGTGCTTGATCCCGCCGCCGCG
GCCGTCCGAGGCATGATCGCCGCCATCCAGGCCGAGTACCCGGACCGTTTCGTCCTTGTG
GACGTCGAGCCGGGCGCGGATCCGGACGCCGGACTGGGCCCGGTGCTGGCCGCCGACGCC
GCACAGGCCGCGGTGCGGGCCGGGCGCGTCCACGTTCCGCGGCTGGTGGCCGTCAACGAA
GCCGGACCGGCCGTCCGGCCACTCGACCCCGACAGCACGGTCCTGATCGTGGGCGGCACC
GACGGGACCGGATCCCGCGTGGCCCGGCACCTGGCCGCCGACCACGGCGTCCGCCACCTG
GTCCTGGCGGACCCACAGGGCGCGGACACCCCCCGATCCGCGGCCCTGGCCGACGAGCTC
GCCGCCCTCAGCGCCTCCGTGTCCGTCGTGGCCTGCGACGTGACCGACCGGGACGCGCTG
CACCGCCTGCTGTCCGCGATACCGGCGGACCATCCGCTGACCGGCGTGGTCCACGCCGCC
GAAACGGCCGACCGCACCCCGCTCGGGGAACTGGACCCGGAACGCCTCGACGCGGTCCTC
GGCGCACGCAGCGACTCGCTGCGGCACCTGGCCGAACTCGCCGCGGGCCGGGAACTCGCC
CTGTTCGCCGTGGTCACCACGGCGGCCGAACTGACCGGTCCGGCCGACCAGGCGGCCACC
GCGGCGGCCGACGGGCTCGCCCGGGCCGCCGCCGCGAGCTGCGGAGCCCGCGTACCGGTG
CTTGCGTCCGCGGACGGTCCGGGACTGTCGGCGCTGTCTGCGGCGATCGGCACCGCCGAA
CAGTTCCCGGTTCCCGGCCGGCCCGATCAGTGGGGCGCGCCCGTGCCCGGCCGGCCGGTC
CCGCCGCTGCTGCGCGGGCTGGTCCGGCCGCGGCGGCGGCCCGCCTACCGGGCGGCGGCC
GGCGCGGAGAGGGCCGACCGGTGGTCGCAGCTCCTGAGTGCGCAGGCCGGTGCGGACCGG
GAGAAGACCGTACTGGACCTGGTGCAGGCGCAGCTGGTTGGGGTCCTTGGACTCGACCCG
GAGGAACCGGTCGAGCCCGAGCGCGGCTTCTTCGAGTCCGGCCTGGACTCCGTGATGGCG
ATCGAACTGGCCCGGCGGCTCAACAGCCACGCCGGCACCGCGCTCACCCCGGCCGGGGTG
TTCAACCACCCGACCCCCGCGGCGCTGACCCGACATCTCGTCGAGCTGATCGAGACGGCC
GGGCGCCGCGTACCCGTCGCCGTCCCTCACCGGTCACACCGAAGTCAAGCCGGAGGATCC
GGGCCCAGGACGGTCAGGTGA
[4] KS35..411
[4] AT564..882
[4] methylmalonyl-CoA755..759
[4] DH931..1094
[4] KR1394..1574
[4] ACP1679..1749
[5] KS1776..2150
[5] AT2306..2623
[5] malonyl-CoA2501..2505
[5] dh2670..2819
[5] KR3097..3277
[5] ACP3376..3450
[6] KS3472..3833
[6] AT3982..4302
[6] methylmalonyl-CoA4171..4175
[6] dh4349..4494
[6] kr4712..4914
[6] ACP4964..5034
[4] KS103..1233
[4] AT1690..2646
[4] methylmalonyl-CoA2263..2277
[4] DH2791..3282
[4] KR4180..4722
[4] ACP5035..5247
[5] KS5326..6450
[5] AT6916..7869
[5] malonyl-CoA7501..7515
[5] dh8008..8457
[5] KR9289..9831
[5] ACP10126..10350
[6] KS10414..11499
[6] AT11944..12906
[6] methylmalonyl-CoA12511..12525
[6] dh13045..13482
[6] kr14134..14742
[6] ACP14890..15102

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-686]  G3DSA:3.40.366.10 [755-870]  G3DSA:3.40.366.10 [2303-2436]  G3DSA:3.40.366.10 [2501-2612]  G3DSA:3.40.366.10 [3974-4103]  G3DSA:3.40.366.10 [4171-4293]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [4713-4874]  1.6e-33 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [918-933]  PS00012 [1707-1722]  PS00012 [3408-3423]  PS00012 [4992-5007]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1679-1749]  PS50075 [3376-3450]  PS50075 [4964-5034]  PS50075
PS50075   ACP_DOMAIN
 [1678-1753]  3.2e-55 G3DSA:1.10.1200.10 [3379-3455]  3.2e-55 G3DSA:1.10.1200.10 [4962-5037]  3.2e-55 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1672-1792]  1.60000240695997e-24 SSF47336 [3373-3488]  3.80000697093586e-26 SSF47336 [4957-5055]  1.29999924468179e-17 SSF47336
SSF47336   ACP_like
 [1683-1748]  4.5e-09 PF00550 [3384-3449]  9.7e-11 PF00550 [4968-5033]  3e-12 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1394-1572]  6e-57 PF08659 [3097-3276]  1.5e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  1.10000000000001e-88 PF00109 [1776-2026]  2.09999999999996e-93 PF00109 [3472-3709]  4.2e-83 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  1.2e-45 PF02801 [2034-2150]  1.09999999999999e-42 PF02801 [3718-3833]  9e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-882]  1.10000000000001e-98 PF00698 [2306-2623]  1.5e-61 PF00698 [3982-4302]  1.5e-71 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-864]  1.59998835313644e-69 SSF52151 [2304-2614]  1.20000117458134e-58 SSF52151 [3980-4274]  4.60000044330862e-46 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [689-754]  1.59999889349252e-16 SSF55048 [2438-2500]  2.39999798157265e-17 SSF55048 [4105-4170]  1e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  G3DSA:3.40.47.10 [298-463]  G3DSA:3.40.47.10 [1778-2038]  G3DSA:3.40.47.10 [2039-2204]  G3DSA:3.40.47.10 [3474-3721]  G3DSA:3.40.47.10 [3722-3880]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-409]  1.39999277195148e-99 SSF53901 [1768-2148]  3.699978135861e-101 SSF53901 [3464-3880]  6.80004680300024e-92 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1392-1577]  9.3000000000001e-83 G3DSA:3.40.50.720 [3097-3304]  9.3000000000001e-83 G3DSA:3.40.50.720 [4711-4887]  9.39999999999981e-81 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1939-1955]  PS00606 [3622-3638]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-863]  1.3000049540733e-114 SM00827 [2308-2604]  2.59998233910302e-102 SM00827 [3984-4284]  1.09999184471405e-86 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1680-1752]  1.39999892049878e-28 SM00823 [3381-3453]  1.89999859865865e-29 SM00823 [4965-5037]  7.00000734129907e-24 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [931-1094]  4.50001022902825e-78 SM00826 [2670-2819]  2.80000504261099e-43 SM00826 [4349-4494]  2.60000517657733e-36 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [1778-2204]  SM00825 [3474-3880]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1394-1574]  2.50000909916183e-54 SM00822 [3097-3277]  4.60000044330862e-57 SM00822 [4712-4914]  2.90000354677981e-21 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit