close all open/close all

CDS information : Rubra_00400


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction77,653 / 81,606 / + [in whole cluster]
77,653 / 81,606 / + [in contig]
Location77653..81606 [in whole cluster]
77653..81606 [in contig]
TypeCDS
Length3,954 bp (1,317 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productaminocoumarin--carboxylic acid ligase/L-tyrosine--PCP ligase/peptidyl carrier protein
amide synthetase/L-tyrosyl-PCP synthetase/peptidyl carrier protein
Product (GenBank)putative CoA ligase
Gene
Gene (GenBank)rubC1
EC number
Keyword
  • aminocoumarin moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[21448870] Adenylate-forming enzymes of rubradirin biosynthesis: RubC1 is a bifunctional enzyme with aminocoumarin acyl ligase and tyrosine-activating domains. (Chembiochem. , 2011)
[23225745] A domain of RubC1 of rubradirin biosynthesis can functionally replace MbtH-like proteins in tyrosine adenylation. (Chembiochem. , 2013)
Related Reference
ACC
Q9L9F6
PmId
[10801869] Cloning, overexpression, and purification of novobiocic acid synthetase from Streptomyces spheroides NCIMB 11891. (J Biol Chem. , 2000)
ACC
Q9L9G0
PmId
[11325587] Coumarin formation in novobiocin biosynthesis: beta-hydroxylation of the aminoacyl enzyme tyrosyl-S-NovH by a cytochrome P450 NovI. (Chem Biol. , 2001)

close this sectionPKS/NRPS Module

B1 tyrosine
A757..1148
PCP1235..1301

close this sectionSequence

selected fasta
>aminocoumarin--carboxylic acid ligase/L-tyrosine--PCP ligase/peptidyl carrier protein [putative CoA ligase]
MRGHDHYIRRILGRLDAHPAGVPFVLGNDPFPAERLARAIRTTAGWMRAAGVGPGTSVAV
LTSPNTPSTLVYRYAVNLLGATAVHIRGVNAADPQDELGPRVQAEILAGLRPSVLAVDQD
NLDRARELRAAAGSAFALAAPGPYGPDVLDMSRPLESPFDDATAERAEIAVVTFTSGSSG
RPKGVCWPFDVKDDMASAAAGAQPAVCLITGTLTHSSGFSADDAIIAGGSVVLHHGFDAE
AVLRAVERHRVTRLVLASAQVYALTEHHAFDDYDRSSLREVFYTGSPAAPERLAAAAKSL
GPVLFQVYGTSETGMISLLTPQDHLDPDLRRTVGRPPANVRITIRDPRDHDRLLPPGVSG
EICSSGRWAMSHYWNDPEQTARTVRDGWVRTGDIGRLDESGYLTLEGRLDGVLKGHGVRI
HPEAIERVLLEHADVAQAAVFGIEDEDFLALVHAVVTPAPGCTPRPADLGAYVADALGDR
HAPVDIEVRSELPLLGSAKPDRNLLREQALGARFWHASLGGVDGDSLLRDRLARPGDDTL
GAPALQRRIPDFPSAKNTLLGVWAVLLHLLGAGSPVVFGAGPRPLLVAVAPGEEIGAVLH
RVEEAVAASAGHARLGPRGRAELDAAADTLFDTALTFTRVGDPPPGPARPLTAELRVGHD
AGDLVLTLVTDPRRIGADCAGRLLEMVLRLLGAFREAPGQPVASLDLLDPATRRQVLQEW
NSSRQEQPAATLGRLWQDAADAHAGRPAVEEAGVTTSYAELDRRAGRLAAAIAQAGAAPG
RMVALLLPRSLDLITALLATVRTGAAFVPIDPGYPPERITAMLEDCDPVAVCTTASADMP
STRPWPRVHLDGPEAGEPAGGFPRVAPDVADPAYVIYTSGTTGRPKGVVVTHAGLANLAA
AKREGLGLDSTARVLQFASPSFDAFVAELLGAFTSGATVVVPPQGPLAGEPLTAVLTERR
ITHAILPPVALSSMDGAAGALPGLRGLISAGEECPAELAARWSQGRRMVNAYGPTEVTVC
ATQSGPLTADGRPPIGRPVAGARAYVLGPGLQPVPPGFRGELYIAGPGVARGYLNQPALT
AVRFVADPFGPPGSRMYRTGDIASWRADGNLDFHGRADDQIKLRGFRIEPREVAAVLEEL
PAVARAVAGVREDRGGRARLIAWVVPADGEAPTPERLREHAARRLPEHMTPTGYVLVSAL
PMTPNGKLDLAALPAVAERDSPPPAAARPALRTPAERALAAIVGELLGATDVGADSDFFA
LGGDSMLAISLIRRAREAGLALSPKEIVGNPTIGALAAVATSLPSPPAQTPHVEGRR
selected fasta
>aminocoumarin--carboxylic acid ligase/L-tyrosine--PCP ligase/peptidyl carrier protein [putative CoA ligase]
TTGCGGGGGCATGATCACTACATCCGCCGGATCCTCGGCCGGCTCGACGCCCATCCTGCC
GGCGTTCCCTTCGTGCTCGGAAACGACCCCTTCCCGGCCGAGCGTCTCGCCCGTGCGATC
CGCACGACCGCCGGGTGGATGCGCGCGGCCGGTGTCGGCCCGGGCACCTCGGTCGCCGTG
CTGACCAGTCCCAACACACCGTCCACCCTGGTGTACCGGTACGCGGTGAACCTCCTGGGC
GCGACGGCGGTCCACATTCGCGGGGTGAACGCCGCGGACCCTCAGGACGAGTTGGGTCCT
CGCGTCCAGGCGGAGATTCTCGCCGGGCTGCGGCCGAGCGTGCTGGCGGTGGACCAGGAC
AACCTCGACCGTGCGCGCGAGCTGCGTGCCGCGGCCGGATCGGCGTTCGCCCTCGCCGCC
CCGGGTCCGTACGGACCGGATGTTCTGGACATGAGCCGCCCCTTGGAGTCGCCGTTCGAC
GACGCGACGGCCGAGCGGGCGGAGATCGCCGTGGTGACGTTCACCAGCGGATCGTCGGGA
CGGCCCAAGGGCGTCTGCTGGCCGTTCGACGTGAAGGACGACATGGCCTCGGCGGCCGCC
GGGGCCCAGCCGGCGGTCTGTCTGATCACCGGGACGCTGACCCACTCCAGCGGTTTCTCG
GCCGATGACGCGATCATCGCCGGGGGCAGTGTCGTGCTGCACCACGGGTTCGACGCCGAG
GCGGTGCTCCGAGCCGTCGAACGGCACCGCGTCACCCGGCTCGTCCTCGCCTCTGCGCAG
GTCTACGCCCTCACCGAGCATCACGCGTTCGACGACTACGACCGCTCCAGCCTGCGCGAG
GTGTTCTACACCGGGAGCCCGGCCGCGCCGGAGCGGCTGGCGGCCGCCGCCAAATCGCTC
GGCCCGGTGCTGTTCCAGGTCTACGGCACGAGCGAGACCGGCATGATCAGCCTGCTCACC
CCACAGGATCATCTGGACCCCGACCTGCGGCGCACGGTCGGCCGGCCCCCGGCGAACGTC
CGGATCACCATCCGTGATCCGCGAGACCACGACCGGCTCCTCCCGCCGGGCGTCTCCGGC
GAGATCTGCTCGTCCGGGCGCTGGGCGATGAGCCACTACTGGAACGACCCGGAGCAGACC
GCGCGGACGGTCCGCGACGGGTGGGTGCGCACCGGCGACATCGGACGGCTCGACGAGTCG
GGATACCTGACCCTCGAGGGCCGCCTCGACGGGGTCCTGAAGGGTCACGGTGTCCGCATC
CACCCGGAGGCGATCGAGCGCGTGCTCCTCGAACACGCCGACGTGGCCCAGGCCGCGGTG
TTCGGGATCGAGGACGAGGATTTCCTGGCGCTGGTCCACGCGGTGGTGACGCCGGCGCCC
GGCTGCACGCCGCGGCCGGCCGACCTGGGGGCGTACGTGGCGGACGCGCTCGGTGACCGC
CATGCTCCGGTGGACATCGAGGTCAGGTCCGAACTGCCGCTGCTGGGATCGGCGAAGCCG
GACCGGAACCTGCTGCGCGAGCAGGCGCTGGGCGCGCGGTTCTGGCACGCGTCGCTAGGG
GGGGTCGACGGTGATTCCCTGCTCCGGGACAGGCTCGCCCGGCCGGGCGACGACACGTTG
GGGGCACCCGCACTCCAGCGGCGGATCCCGGATTTCCCGTCCGCAAAGAACACGCTGCTC
GGAGTCTGGGCGGTCCTGCTGCACCTGCTGGGCGCCGGCTCGCCGGTCGTCTTCGGGGCC
GGGCCCCGGCCGCTGCTGGTGGCCGTCGCGCCGGGCGAGGAGATCGGCGCCGTCCTCCAC
CGGGTCGAGGAGGCCGTGGCCGCCTCGGCCGGGCACGCCCGGCTGGGACCGCGGGGGCGG
GCCGAACTCGACGCCGCGGCAGACACGTTGTTCGACACCGCGCTCACCTTCACCCGTGTC
GGGGACCCGCCGCCCGGCCCGGCCCGGCCGCTCACGGCCGAGCTCAGGGTGGGCCACGAC
GCGGGCGATCTCGTCCTGACCCTGGTCACCGACCCGCGGCGGATCGGCGCGGACTGCGCC
GGACGCCTCCTCGAGATGGTCCTGCGCCTGCTCGGGGCATTTCGCGAGGCGCCCGGCCAG
CCGGTCGCCTCGCTGGACCTCCTCGACCCGGCCACCCGCCGCCAGGTGCTGCAGGAATGG
AACTCCTCCCGGCAGGAGCAGCCCGCCGCGACCCTGGGCCGGCTGTGGCAGGACGCTGCG
GACGCACACGCCGGACGGCCGGCCGTGGAAGAGGCCGGCGTCACCACCTCGTACGCCGAA
CTCGACCGCCGTGCCGGCCGGCTCGCGGCGGCCATCGCGCAGGCGGGTGCGGCGCCGGGC
CGGATGGTGGCCCTCCTGCTGCCGCGGTCCCTGGACCTGATCACCGCGCTCCTGGCGACC
GTCCGGACCGGCGCGGCGTTCGTCCCCATCGACCCGGGATACCCGCCAGAGCGGATCACG
GCGATGCTGGAGGACTGCGACCCGGTGGCGGTCTGCACGACGGCGTCGGCCGACATGCCC
TCGACCCGTCCCTGGCCGCGCGTCCACCTGGACGGGCCGGAGGCCGGCGAGCCGGCGGGC
GGGTTTCCCCGGGTCGCGCCCGACGTGGCCGATCCGGCGTACGTCATCTACACCTCCGGC
ACGACCGGCCGGCCGAAGGGCGTCGTGGTCACCCACGCCGGGCTGGCGAACCTGGCCGCG
GCCAAACGCGAGGGCCTGGGACTGGACAGCACCGCCCGGGTCCTGCAGTTCGCCTCACCG
AGCTTCGACGCGTTCGTCGCCGAGCTGTTGGGCGCGTTCACCTCGGGGGCGACGGTGGTC
GTGCCGCCGCAGGGCCCCCTCGCCGGAGAACCGCTGACGGCGGTTCTGACCGAGCGCCGG
ATCACCCACGCCATCCTGCCGCCGGTGGCACTGTCCAGCATGGACGGCGCCGCCGGCGCA
CTGCCCGGGCTCCGCGGCCTGATCAGCGCGGGCGAGGAGTGCCCGGCCGAGCTGGCCGCG
CGCTGGTCGCAGGGCCGCCGGATGGTCAACGCCTACGGGCCCACCGAGGTCACCGTCTGC
GCCACTCAGAGCGGGCCGCTCACGGCAGACGGCCGGCCTCCGATCGGACGGCCCGTCGCC
GGTGCCCGCGCCTACGTGCTCGGCCCCGGGCTGCAGCCGGTGCCACCCGGATTCCGCGGC
GAGCTCTACATCGCGGGCCCCGGCGTCGCCCGGGGTTACCTCAACCAGCCCGCCCTGACA
GCCGTACGCTTCGTGGCGGACCCGTTCGGCCCGCCCGGCAGCCGGATGTACCGCACCGGC
GACATCGCCTCCTGGCGCGCCGACGGCAACCTGGACTTCCACGGCCGGGCCGACGACCAG
ATCAAACTGCGGGGCTTTCGGATCGAGCCGCGCGAGGTGGCGGCGGTGCTGGAGGAACTG
CCCGCGGTCGCCCGTGCGGTGGCCGGCGTACGCGAGGACCGTGGCGGCCGGGCCCGGCTG
ATCGCCTGGGTCGTGCCCGCCGACGGGGAGGCACCCACCCCCGAGCGGCTCCGGGAGCAC
GCGGCACGCCGGCTGCCGGAGCACATGACGCCGACGGGGTACGTCCTCGTCAGTGCCCTG
CCCATGACGCCGAACGGCAAGCTGGACCTGGCCGCGCTGCCCGCGGTCGCCGAGCGGGAC
AGTCCCCCGCCCGCGGCGGCGCGGCCGGCCCTGCGCACGCCGGCGGAACGCGCGCTGGCC
GCCATCGTCGGGGAGCTGCTGGGCGCCACGGACGTCGGCGCCGACAGCGACTTCTTCGCG
CTCGGCGGCGACAGCATGCTGGCCATCTCGCTGATCCGGCGCGCCCGCGAAGCGGGTCTG
GCCCTCTCCCCCAAGGAGATCGTGGGAAACCCCACGATCGGTGCCCTCGCCGCGGTGGCC
ACCTCGCTGCCGTCCCCGCCCGCCCAGACGCCTCACGTGGAAGGCCGCCGATGA
[1] A757..1148
[1] tyrosine923..1020
[1] PCP1235..1301
[1] A2269..3444
[1] tyrosine2767..3060
[1] PCP3703..3903

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [36-440]  7.4e-63 PF00501 [757-1147]  1.60000000000002e-106 PF00501
PF00501   AMP-binding
IPR009081 Acyl carrier protein-like (Domain)
 [1228-1302]  1.39999892049878e-15 SSF47336
SSF47336   ACP_like
 [1229-1302]  5.80000000000004e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1235-1301]  PS50075
PS50075   ACP_DOMAIN
 [1238-1298]  7.7e-13 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [757-1148]  2.20000000000002e-123 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [172-183]  PS00455 [875-886]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-27]  0.136 Signal
Eukaryota   
TMHMM No significant hit