close all open/close all

CDS information : Rubra_00410


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction81,603 / 82,832 / + [in whole cluster]
81,603 / 82,832 / + [in contig]
Location81603..82832 [in whole cluster]
81603..82832 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450
Gene
Gene (GenBank)rubC2
EC number
Keyword
  • aminocoumarin moiety
  • hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q9L9F9
PmId
[11325587] Coumarin formation in novobiocin biosynthesis: beta-hydroxylation of the aminoacyl enzyme tyrosyl-S-NovH by a cytochrome P450 NovI. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450]
MTRPVVSPELLDSLDLADPVLHAENELSEVWRRLRQERSHYWHPARGDRPGFWVFTPYAD
AMAVYRDKEHFTTEGGNALATLLAGGDSASGSMLAVTDGDKHTQLRNVLNAAFSPRRLKT
IRTAIRRTIDDLIRAAIDKGECDFVHDVSANVPLGAICGLMDVPEADRRYLLGLTSHAWS
SDYADAPPQESWQAKSEILLYFADLAHTRRGSDADDVVSLLANCRIGGGPLSDADLMSNC
YGLMIGGDETGRHAISGGLQALIEWPDQWRALKEGTVGLDTAANEVLRWTVPSLHGGRTA
SGDTTVNGQPVKKGDIVSVWISSANRDPEVFADPDRFLLDRRPNKHLTFAFGSHLCLGHT
LARIEVEEILDSLRTLVSCAEQTGPERWIYSSILHGMSSLPVTLTPEPA
selected fasta
>putative cytochrome P450 [putative cytochrome P450]
ATGACCCGCCCCGTAGTCAGCCCTGAGCTCCTGGATTCGCTCGACCTCGCCGACCCGGTG
CTGCACGCCGAGAACGAACTCTCCGAGGTGTGGCGCCGGCTCCGGCAGGAGCGGTCCCAC
TACTGGCATCCGGCGCGGGGGGACCGTCCCGGCTTCTGGGTCTTCACCCCGTACGCCGAC
GCGATGGCGGTCTACCGGGACAAGGAACACTTCACCACCGAAGGCGGCAACGCGCTGGCG
ACCCTGCTGGCCGGCGGCGACTCGGCGTCCGGCTCGATGCTCGCGGTGACCGACGGCGAC
AAGCACACCCAGCTGCGCAACGTGCTCAACGCGGCGTTCTCCCCTCGCCGGCTCAAGACC
ATCCGCACGGCGATCCGGCGGACCATCGACGACCTGATCCGGGCGGCGATCGACAAAGGC
GAGTGCGATTTCGTCCACGACGTGTCCGCGAACGTCCCGCTGGGTGCGATCTGTGGCCTC
ATGGACGTGCCCGAGGCGGATCGCCGCTATCTGCTCGGGCTCACCTCGCACGCGTGGAGT
TCCGACTACGCGGACGCCCCGCCGCAGGAGAGCTGGCAGGCCAAGAGCGAGATCCTGCTC
TACTTCGCCGACCTGGCGCACACCCGGCGCGGCAGTGACGCCGACGACGTGGTCAGCCTG
CTGGCCAACTGCCGCATCGGGGGCGGGCCGTTGAGCGACGCCGACCTGATGTCCAACTGC
TACGGGCTGATGATCGGCGGCGACGAGACCGGACGGCATGCCATCTCCGGCGGTCTGCAG
GCACTGATCGAGTGGCCGGACCAGTGGCGGGCGCTCAAGGAGGGCACCGTCGGCCTCGAC
ACCGCCGCCAACGAGGTGCTGCGCTGGACCGTGCCGTCCCTGCACGGCGGACGCACGGCG
TCCGGGGACACCACGGTGAACGGCCAGCCGGTCAAGAAGGGCGACATCGTCAGCGTCTGG
ATCTCCTCGGCCAACCGGGACCCCGAGGTCTTCGCCGACCCGGACCGCTTCCTCCTCGAC
CGCAGGCCGAACAAGCACCTGACCTTCGCCTTCGGCTCGCACCTCTGCCTGGGGCACACG
CTGGCACGCATCGAAGTGGAGGAAATCCTCGACTCGTTGCGCACGCTCGTGTCGTGCGCG
GAACAGACCGGGCCGGAGCGGTGGATCTACTCCAGCATCCTGCACGGCATGAGCTCCCTG
CCGGTCACGCTGACGCCCGAGCCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [1-406]  3.10001307370203e-81 SSF48264
SSF48264   Cytochrome_P450
 [24-406]  1.5e-90 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [280-370]  1.9e-15 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [97-108]  7.2000271977897e-37 PR00359 [143-159]  7.2000271977897e-37 PR00359 [160-175]  7.2000271977897e-37 PR00359 [200-222]  7.2000271977897e-37 PR00359 [281-292]  7.2000271977897e-37 PR00359 [298-325]  7.2000271977897e-37 PR00359 [326-341]  7.2000271977897e-37 PR00359 [347-356]  7.2000271977897e-37 PR00359 [356-367]  7.2000271977897e-37 PR00359
PR00359   BP450
SignalP
 [1-47]  0.032 Signal
Bacteria, Gram-negative   
TMHMM No significant hit