close all open/close all

CDS information : Rubra_00420


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction82,829 / 83,578 / + [in whole cluster]
82,829 / 83,578 / + [in contig]
Location82829..83578 [in whole cluster]
82829..83578 [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative beta-hydroxytyrosyl-S-PCP dehydrogenase
Product (GenBank)putative oxyacyl-(acyl carrier protein) reductase
Gene
Gene (GenBank)rubC3
EC number
Keyword
  • aminocoumarin moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q9L9F8
PmId
[16171397] NovJ/NovK catalyze benzylic oxidation of a beta-hydroxyl tyrosyl-S-pantetheinyl enzyme during aminocoumarin ring formation in novobiocin biosynthesis. (Biochemistry. , 2005)

close this sectionSequence

selected fasta
>putative beta-hydroxytyrosyl-S-PCP dehydrogenase [putative oxyacyl-(acyl carrier protein) reductase]
MNRVAIVTGSARGIGAAVAGRLVGDGIDVAVLDVDVTAAQSTAAGLVRAGGRAGAIGVDV
SDADAVSTAVDEVVDRFGPPCILVNNAGITRDNMVFSLSPADWDLVINVNLRGTFLMTHA
VAEHMAKLGWGRVVNLSSIAAVGNPGQANYSAAKAGIEGLTKTLALELGPLNVTVNAVAP
GYVATEMTAALAAQAGRTAEEHQAQAAATIPLRRVGRPEDIADVVAFLASDHASFVSGQI
IHVAGGPVC
selected fasta
>putative beta-hydroxytyrosyl-S-PCP dehydrogenase [putative oxyacyl-(acyl carrier protein) reductase]
GTGAACCGCGTCGCCATCGTCACCGGATCGGCCCGGGGCATCGGTGCCGCGGTGGCCGGC
AGGCTGGTCGGGGACGGCATCGACGTCGCCGTCCTCGACGTGGACGTGACGGCCGCGCAG
AGCACGGCCGCCGGCCTGGTCCGGGCGGGCGGCCGCGCCGGGGCCATCGGGGTCGACGTG
AGCGACGCCGACGCGGTCAGCACGGCGGTCGACGAAGTCGTCGACCGGTTCGGGCCGCCC
TGCATCCTGGTCAACAACGCCGGCATCACCCGGGACAACATGGTCTTCTCCCTCTCACCG
GCCGACTGGGACCTGGTCATCAACGTGAACCTGCGCGGCACATTCCTGATGACGCACGCG
GTCGCCGAGCACATGGCCAAGCTCGGCTGGGGCCGCGTGGTGAACCTGTCGAGCATCGCT
GCGGTCGGCAACCCCGGCCAGGCCAACTATTCGGCGGCGAAAGCCGGAATCGAGGGCCTG
ACCAAGACGCTGGCCCTGGAACTCGGTCCGCTGAACGTCACAGTCAACGCCGTGGCGCCC
GGCTACGTGGCCACCGAGATGACCGCGGCCCTGGCGGCGCAGGCCGGCCGGACGGCCGAG
GAACACCAGGCGCAGGCCGCGGCGACGATCCCGCTGCGCCGGGTCGGCCGGCCGGAGGAC
ATCGCCGACGTCGTGGCCTTCCTGGCCAGCGACCATGCCTCGTTCGTGTCCGGCCAGATC
ATCCATGTCGCCGGCGGACCGGTCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [4-168]  3.29999999999997e-35 PF00106
PF00106   adh_short
 [78-89]  3.0999994589937e-12 PR00080 [131-139]  3.0999994589937e-12 PR00080 [150-169]  3.0999994589937e-12 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [4-21]  2.39999798157265e-46 PR00081 [78-89]  2.39999798157265e-46 PR00081 [125-141]  2.39999798157265e-46 PR00081 [150-169]  2.39999798157265e-46 PR00081 [171-188]  2.39999798157265e-46 PR00081 [211-231]  2.39999798157265e-46 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-247]  2.79999999999994e-84 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [137-165]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-19]  0.456 Signal
Bacteria, Gram-negative   
TMHMM No significant hit