close all open/close all

CDS information : Rubra_00440


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction84,130 / 84,912 / + [in whole cluster]
84,130 / 84,912 / + [in contig]
Location84130..84912 [in whole cluster]
84130..84912 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • ORF12
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [hypothetical protein]
MPESSAHLRAWLRRFSPAGDAMSLLVCLPHAGGSASFFFPLARALAPEVDVLAVQYPGRQ
DRHHEPSIDNLPELADRITDAVRLVDDRPLALFGHSMGALLAYEVALRLAADGLPAPSRL
FVSGRRAPSRYRDDRFHLSSDGDVLAHLRRLGGPGSTALDDPEIRAMALPLIRNDYRAVE
TYRHDPSAVLDCPVTVLTGDRDALVSPEEAHAWAGHTTGPTDVVTLPGGHFYLADQNEQV
VALLRRRLAAVTAQQTPRLR
selected fasta
>putative type II thioesterase [hypothetical protein]
ATGCCGGAGTCATCGGCGCACCTGAGGGCCTGGCTGCGCCGCTTCAGCCCGGCCGGGGAC
GCGATGTCCCTCCTGGTCTGCCTGCCGCACGCGGGCGGATCGGCCAGTTTCTTCTTCCCG
CTCGCGCGAGCGCTGGCCCCCGAGGTCGACGTACTGGCCGTGCAGTACCCGGGCCGGCAG
GACCGCCATCACGAGCCGAGCATCGACAACCTCCCGGAACTGGCCGACCGGATCACCGAC
GCGGTGCGGCTCGTGGACGACCGGCCCCTCGCCCTGTTCGGACACAGCATGGGGGCGCTG
CTGGCGTACGAGGTCGCCCTGCGGCTGGCCGCCGACGGGCTGCCCGCACCGTCCCGCCTG
TTCGTCTCCGGGCGCCGGGCGCCGTCCCGGTACCGGGACGACCGGTTCCACCTGTCCTCG
GACGGTGACGTCCTCGCCCACCTGCGCCGGCTCGGCGGTCCCGGTTCGACGGCACTCGAC
GACCCGGAGATCCGGGCGATGGCCCTCCCCCTCATCCGCAACGACTACCGTGCGGTGGAG
ACCTACCGGCATGATCCGTCCGCCGTCCTGGACTGCCCGGTCACCGTACTCACCGGCGAC
CGCGACGCACTGGTGAGCCCGGAGGAGGCGCACGCCTGGGCCGGGCACACGACCGGGCCG
ACCGACGTCGTGACACTGCCCGGCGGTCATTTCTACCTGGCCGACCAAAACGAGCAGGTC
GTGGCGCTCCTTCGTCGGCGGCTCGCGGCCGTCACCGCGCAGCAGACACCGCGTCTGCGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [25-244]  1.9e-52 PF00975
PF00975   Thioesterase
SignalP
 [1-44]  0.984 Signal
Eukaryota   
TMHMM No significant hit