close all open/close all

CDS information : Rubra_00450


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction85,136 / 85,948 / + [in whole cluster]
85,136 / 85,948 / + [in contig]
Location85136..85948 [in whole cluster]
85136..85948 [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative hydroxylase
Gene
Gene (GenBank)rubP4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q2PC57
NITE
Rubra_00330
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative hydroxylase]
MSVLVTGAYGDVGSHVVAGLLSAGVPVRGTSRTPRTGESPDGVEMVRLDLDEPETWPAAL
DGVKKVFLYAHADRVADFAGAARAAGVEHIVLLSSAAVVDPATRHSRSAVMHSAVEEALR
ESGIAWTFLRPTTFATKQLHLAPAIRSGEVLRIPFLQAPTASIHERDIADAAVCALTGAG
HEGKGYWLTGPQALTQQEHIEVIAAVTGRPIEVVDLAPEDAEPKLPEFFIRIMTELMNNP
CVVTPAVEEITGVPARSFRQWAEDHIKDFS
selected fasta
>hypothetical protein [putative hydroxylase]
TTGTCCGTTCTTGTCACTGGTGCGTACGGCGATGTCGGCAGCCATGTGGTGGCCGGGCTG
TTGTCTGCCGGAGTCCCGGTCCGCGGGACCAGCCGGACGCCGCGCACCGGCGAGTCGCCG
GATGGCGTCGAGATGGTCCGCCTCGACCTGGACGAGCCGGAGACCTGGCCGGCGGCGCTC
GACGGCGTCAAGAAGGTCTTCCTGTACGCCCATGCGGACCGTGTCGCCGATTTCGCCGGT
GCGGCGCGGGCTGCCGGGGTGGAGCACATCGTGCTGCTGTCCTCGGCCGCCGTGGTCGAT
CCCGCCACCCGGCACAGCCGCAGCGCGGTGATGCACTCCGCGGTGGAGGAAGCGCTCCGG
GAATCCGGGATCGCCTGGACGTTCCTGCGTCCCACCACCTTCGCCACGAAACAGCTTCAC
CTGGCGCCGGCGATCCGGTCCGGGGAAGTACTGCGGATTCCCTTCCTGCAAGCCCCCACC
GCGTCGATCCACGAACGCGACATCGCCGACGCGGCGGTCTGCGCGCTGACCGGTGCCGGG
CACGAGGGGAAGGGGTACTGGCTGACCGGGCCGCAGGCCCTGACGCAGCAGGAGCACATC
GAGGTGATCGCAGCGGTGACCGGGCGGCCGATCGAGGTGGTCGACCTGGCTCCCGAGGAC
GCCGAGCCCAAGCTCCCGGAGTTCTTCATCCGGATCATGACCGAACTCATGAACAATCCG
TGCGTCGTGACACCCGCCGTCGAGGAGATCACCGGAGTGCCGGCCCGCTCGTTCCGGCAG
TGGGCCGAGGACCACATCAAGGACTTCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-212]  9.40000000000003e-42 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit