close all open/close all

CDS information : Rubra_00460


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction86,106 / 87,158 / + [in whole cluster]
86,106 / 87,158 / + [in contig]
Location86106..87158 [in whole cluster]
86106..87158 [in contig]
TypeCDS
Length1,053 bp (350 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate synthase
Product (GenBank)putative aDHQ synthase
Gene
Gene (GenBank)rubG
EC number4.2.3.-
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52549
NITE
Rifam_00280
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P0A4Z4
PmId
[17586643] Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. (J Bacteriol. , 2007)
[1910148] The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. (Mol Gen Genet. , 1991)

close this sectionSequence

selected fasta
>putative aminodehydroquinate synthase [putative aDHQ synthase]
MTAVSLRLRDQSYEVIIGPGVRTALAGVVRRLGAQRAVVVSARPRPWVPDTGVPSLVLPA
LDGEQGKTLGTVESLCGEFARFGLTRSDVVVSCGGGTTTDVVGLAAALYHRGVPVVHLPT
SLLAQVDAGVGGKTAVNLPAGKNLVGTYWQPSAVLCDTDYLSTLPRREMLSGLGEIARCH
FIGAPDLRGLPLAEQITASVRLKARIVEADERDTGMRHLLNYGHTLGHAVERATGYAVRH
GEAVAIGTVFAGRLAGALGRIGQARVAEHHDVVRHYGLPAALPAEAGTAALMRLMRQDKK
AVRGLTFVLDGPKGAELVSDVPPDVVAGVLEGMPRTCMADLVASSGGAGR
selected fasta
>putative aminodehydroquinate synthase [putative aDHQ synthase]
ATGACCGCGGTTTCTCTGCGTCTGAGAGATCAGTCGTATGAGGTGATCATTGGTCCGGGG
GTGCGGACGGCGCTCGCCGGCGTCGTCCGGCGGCTGGGCGCCCAGCGAGCGGTCGTCGTG
TCGGCTCGCCCACGGCCATGGGTGCCCGACACCGGGGTGCCCAGCCTGGTGCTGCCCGCG
CTCGACGGCGAGCAGGGCAAGACCCTCGGTACGGTGGAGTCGTTGTGCGGTGAGTTCGCA
CGGTTCGGGCTGACCAGGTCCGACGTGGTGGTCTCGTGCGGCGGCGGTACCACCACGGAT
GTCGTCGGGCTGGCGGCCGCGCTGTACCACCGGGGCGTGCCGGTGGTTCATCTGCCGACC
TCCCTGCTGGCCCAGGTGGATGCCGGCGTCGGCGGGAAGACGGCGGTGAACCTGCCCGCC
GGCAAGAACCTGGTCGGCACGTACTGGCAGCCCAGCGCGGTGCTCTGCGACACTGACTAC
CTGTCGACCCTGCCGCGGCGGGAGATGCTCAGTGGCCTCGGCGAAATCGCCCGCTGCCAC
TTCATCGGGGCGCCGGACCTGCGGGGGCTGCCCCTGGCCGAGCAGATCACGGCCAGCGTG
CGGCTCAAGGCCCGCATCGTGGAGGCGGACGAGCGGGACACCGGGATGCGGCACCTGCTC
AACTACGGCCACACGCTGGGCCATGCGGTGGAGAGAGCGACGGGCTACGCGGTGCGGCAC
GGCGAGGCGGTGGCCATCGGAACGGTCTTCGCGGGACGGCTCGCCGGTGCTCTGGGCCGT
ATCGGGCAGGCCCGGGTGGCAGAGCATCACGACGTCGTCCGGCATTACGGGCTTCCCGCC
GCACTGCCGGCCGAGGCCGGCACCGCCGCCCTGATGCGGTTGATGCGGCAGGACAAGAAG
GCGGTCCGGGGACTCACCTTCGTCCTGGACGGCCCCAAGGGCGCGGAGCTGGTGAGCGAC
GTCCCGCCGGATGTGGTCGCGGGGGTGCTGGAGGGGATGCCGCGCACGTGCATGGCCGAC
CTCGTCGCTTCGTCGGGTGGGGCTGGTCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016037 3-dehydroquinate synthase AroB (Family)
 [2-338]  1.50000965748778e-79 PIRSF001455
PIRSF001455   DHQ_synth
SignalP
 [1-34]  0.156 Signal
Bacteria, Gram-negative   
 [1-34]  0.101 Signal
Eukaryota   
TMHMM No significant hit