close all open/close all

CDS information : Rubra_00470


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction87,155 / 88,378 / + [in whole cluster]
87,155 / 88,378 / + [in contig]
Location87155..88378 [in whole cluster]
87155..88378 [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 3,4-dideoxy-4-amino-D-arabino-heptulosonate 7-phosphate synthase
putative aminoDAHP synthase
Product (GenBank)putative aDAHP synthase
Gene
Gene (GenBank)rubH
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
O52550
NITE
Rifam_00290
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[11804477] Biosynthesis of 1-deoxy-1-imino-D-erythrose 4-phosphate: a defining metabolite in the aminoshikimate pathway. (J Am Chem Soc. , 2002)

close this sectionSequence

selected fasta
>putative 3,4-dideoxy-4-amino-D-arabino-heptulosonate 7-phosphate synthase [putative aDAHP synthase]
MTHFPPLDGLLAGRLEAVFRKPAAQQPVWPDPDRAREAVAALSRAEPIVAPEETARLARR
LAAVARGEAFLLQGGDCAETFAGGTEAHQRGNLRTLTGMAAVLVQRAGLPVVRVARMAGQ
YAKPRSQAVDALGLPVYRGDMVNSAESTPAARTPDPGRMLRAHACAARTMGLVRAFCPGG
AAGSEIYVSHEALLLDYERTQLRVDTSGPEPRLSSGLGHFLWIGERTRRLDGAHLAFAEL
LSNPIGVKIGPSTTPEQAVEYVRRLDPHGEPGRVTLVSRMGHTRVRDVLPPIVEKVTASG
SQVIWQCDPMHGNTYVSANGYKTRHLRQIVDEVAGFFEVHRRLGTHPGGLHVEMTGDDVT
ECLGGAPAVAEECLPARYETACDPRLNARQAMGLACSVAEMVAASRT
selected fasta
>putative 3,4-dideoxy-4-amino-D-arabino-heptulosonate 7-phosphate synthase [putative aDAHP synthase]
ATGACGCATTTTCCCCCGCTGGACGGCCTTCTCGCCGGGCGGCTGGAAGCGGTGTTCCGC
AAGCCGGCGGCGCAGCAGCCGGTGTGGCCCGATCCGGACCGGGCACGGGAGGCGGTGGCC
GCGCTGAGCCGGGCCGAGCCGATCGTCGCGCCGGAGGAGACCGCGCGGCTGGCCCGCCGG
CTCGCCGCAGTTGCCCGGGGCGAGGCGTTCTTGCTGCAGGGAGGGGACTGTGCGGAGACC
TTCGCCGGCGGCACCGAGGCGCACCAGCGGGGCAATCTCCGGACGCTGACCGGTATGGCC
GCGGTGCTCGTCCAGCGTGCCGGATTGCCCGTCGTCAGGGTCGCTCGCATGGCGGGGCAG
TACGCCAAGCCGCGCTCCCAGGCCGTCGATGCCCTGGGGCTGCCCGTCTACCGCGGCGAT
ATGGTCAACTCCGCCGAATCCACGCCCGCGGCCCGGACACCCGATCCCGGCCGGATGCTG
CGGGCCCACGCCTGTGCCGCCCGCACCATGGGGCTTGTCCGCGCGTTCTGCCCGGGCGGC
GCGGCCGGCAGCGAGATCTACGTCAGCCACGAGGCGCTGCTGCTCGACTACGAAAGGACG
CAGCTGCGGGTCGACACCAGCGGGCCGGAGCCGCGTCTGTCCAGTGGGCTGGGGCACTTC
CTGTGGATCGGCGAGCGCACCCGCCGGCTCGACGGCGCCCATCTCGCCTTCGCGGAGCTG
CTGTCCAACCCCATCGGCGTCAAGATCGGTCCGTCGACGACCCCGGAGCAGGCGGTCGAG
TATGTGCGCCGGCTCGACCCTCACGGTGAGCCTGGGCGGGTCACGCTGGTCAGCCGTATG
GGGCACACCCGGGTCCGTGACGTTCTGCCTCCGATCGTGGAGAAGGTCACTGCCTCCGGC
TCTCAGGTGATCTGGCAGTGCGATCCCATGCACGGCAACACCTACGTGTCGGCGAACGGC
TACAAGACGCGCCATCTGCGTCAGATAGTCGACGAGGTCGCCGGTTTCTTCGAGGTGCAT
CGACGGCTGGGCACCCACCCCGGCGGCCTCCACGTGGAGATGACGGGCGATGACGTCACG
GAATGTCTCGGTGGTGCCCCGGCCGTCGCGGAGGAGTGTCTGCCGGCCCGCTACGAGACG
GCGTGTGATCCCCGCCTGAATGCCCGGCAGGCGATGGGGCTCGCCTGTTCGGTCGCGGAG
ATGGTCGCGGCGTCCCGGACGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002480 DAHP synthetase, class II (Family)
 [17-182]  3.80000000000003e-57 PF01474 [184-399]  4.59999999999996e-97 PF01474
PF01474   DAHP_synth_2
SignalP No significant hit
TMHMM No significant hit