close all open/close all

CDS information : Rubra_00480


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction89,824 / 88,622 / - [in whole cluster]
89,824 / 88,622 / - [in contig]
Locationcomplement(88622..89824) [in whole cluster]
complement(88622..89824) [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450
Gene
Gene (GenBank)rubP2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q2PC84
NITE
Rubra_00060
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
ACC
P48635
PmId
[8416893] Identification of a Saccharopolyspora erythraea gene required for the final hydroxylation step in erythromycin biosynthesis. (J Bacteriol. , 1993)
[7849045] Overproduction and characterization of the erythromycin C-12 hydroxylase, EryK. (Biochemistry. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450]
MSVSQSERTLSNFLAYLDGLRARGGVHFDEKIKAWHVLGYHDTQQVQTDPVTFSSEVAPL
APKQEDFELSNKGNFVRADDPEHRRLRGLVSKAFTPKMIADLEPRIAELATQLLDAADAR
GGRWDFIKELGHPLPFLVMTELLGIPEDDRAFIRNLSDRFVEVQSYDAEESLDGQKENAA
NNVAPLLHELNQYLLDILRARRENPSDDLAGRLMTVEADGARLDEEEALGFLNLLVAGHH
TTTATLGNTVLALGENPHGWDQLRADPALIPAAIEESVRFRPPFPRSARQTTKDTELGGR
HIPAGAVVLVWLTAANRDDRVFADPNRFDILRKPNPHLSFGKGIHHCLGAPLARLETRTV
IRLMLERYRDIRVRDDAPVTLRNPWQMIGVSKLPIEVRPY
selected fasta
>putative cytochrome P450 [putative cytochrome P450]
ATGAGTGTGAGCCAGTCCGAACGGACACTGTCCAACTTCCTCGCCTATCTCGACGGGCTG
CGGGCGCGTGGAGGCGTGCATTTCGACGAGAAGATCAAGGCGTGGCACGTGCTCGGTTAC
CACGACACCCAGCAGGTGCAGACCGACCCGGTGACGTTCTCCTCCGAGGTCGCCCCGCTG
GCGCCGAAACAAGAAGACTTCGAGCTGTCCAACAAGGGCAACTTCGTCCGGGCCGACGAC
CCTGAACACCGCCGGCTGCGCGGCCTGGTCAGCAAGGCGTTCACTCCGAAAATGATCGCC
GACCTCGAGCCGCGCATCGCCGAACTGGCCACGCAGCTGCTCGATGCCGCCGACGCCCGC
GGCGGCCGGTGGGACTTCATCAAAGAACTGGGCCACCCGCTGCCGTTCCTGGTCATGACC
GAACTGCTCGGCATCCCCGAAGACGACCGCGCCTTCATCCGGAACCTGTCCGACCGGTTC
GTCGAGGTGCAGAGCTACGACGCGGAGGAGTCGCTGGACGGCCAGAAGGAAAACGCGGCG
AACAACGTCGCGCCGCTGTTGCACGAGCTGAACCAGTACCTCCTGGACATCCTCCGCGCC
CGCCGTGAAAACCCCAGCGACGACCTGGCCGGAAGGCTCATGACGGTCGAGGCCGACGGG
GCGCGGCTGGACGAGGAGGAGGCCCTCGGTTTCCTCAACCTGCTGGTCGCCGGCCACCAC
ACCACCACCGCCACCCTGGGCAACACGGTTCTCGCGCTCGGCGAGAACCCCCACGGGTGG
GACCAGCTGCGGGCCGACCCGGCGCTGATCCCGGCCGCGATCGAGGAGTCGGTGCGCTTC
CGTCCGCCCTTCCCGCGTTCGGCCCGGCAGACGACGAAGGACACCGAACTCGGCGGCCGG
CACATCCCGGCCGGCGCGGTCGTCCTGGTGTGGCTGACCGCCGCGAACCGCGACGACCGC
GTCTTCGCCGACCCGAACCGGTTCGACATCCTCCGCAAGCCCAATCCGCACCTGTCGTTC
GGCAAGGGCATACACCACTGCCTGGGCGCACCACTGGCACGGCTGGAGACACGGACCGTG
ATACGCCTCATGCTGGAGCGCTACCGTGACATCCGCGTGCGCGACGACGCCCCCGTCACC
CTGCGCAACCCCTGGCAGATGATCGGCGTCAGCAAGCTGCCCATCGAGGTCCGCCCCTAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [67-396]  4.40000000000001e-31 PF00067
PF00067   p450
 [9-399]  1.69999999999998e-102 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [8-399]  6.29998179434741e-94 SSF48264
SSF48264   Cytochrome_P450
 [237-254]  1.60000065022528e-06 PR00385 [272-283]  1.60000065022528e-06 PR00385 [338-347]  1.60000065022528e-06 PR00385 [347-358]  1.60000065022528e-06 PR00385
PR00385   P450
IPR002397 Cytochrome P450, B-class (Family)
 [78-89]  2.19999900980707e-51 PR00359 [125-141]  2.19999900980707e-51 PR00359 [142-157]  2.19999900980707e-51 PR00359 [192-214]  2.19999900980707e-51 PR00359 [272-283]  2.19999900980707e-51 PR00359 [289-316]  2.19999900980707e-51 PR00359 [317-332]  2.19999900980707e-51 PR00359 [338-347]  2.19999900980707e-51 PR00359 [347-358]  2.19999900980707e-51 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit