close all open/close all

CDS information : Rubra_00490


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction91,154 / 89,958 / - [in whole cluster]
91,154 / 89,958 / - [in contig]
Locationcomplement(89958..91154) [in whole cluster]
complement(89958..91154) [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)rubG2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>glycosyltransferase [putative glycosyltransferase]
MKILFSSHPGYGHTHPLLPLALAARQAGHDVLYATGERFHPLLRGLGFCTVPAGMPIRDA
FAAALAGTDGTNGQVPPEEWLEPAVRVLNEILPRRFAADLLPVLRAQRPDLVVYQAGNPG
AGLAAHRAGIPAVCHANARAEAIDPADRWQRRGMQLLRAVAAENGVELPEGQYLLGDRYL
DIYPDPLQETSFVDRPERMLLRPVPFNESGELPQIVLAGRKRPLVYLTLGTVLGTAAALR
AAVDGLSALDAEVVVAAGPNISLADFPALPAHVHLKQWVPQAELLSLADLAVHHGGSATT
LGAAGSGVPQLFLPIGFDGFLNAGAVAAAGAGRRLLPEGVQRWEDRRRCDVVSAAAVTEA
AGGLLADPGARQAAKAIAEEIATMPSPADIAARLPEFC
selected fasta
>glycosyltransferase [putative glycosyltransferase]
ATGAAGATCCTTTTCTCCAGCCATCCCGGTTATGGCCACACCCACCCTTTGCTGCCGCTG
GCCCTAGCCGCCCGGCAGGCCGGCCATGACGTCCTGTATGCCACGGGTGAGAGATTCCAC
CCGCTGCTGCGAGGGCTCGGATTTTGTACCGTGCCGGCCGGGATGCCGATCCGGGATGCC
TTCGCCGCCGCCTTAGCAGGGACGGACGGGACGAACGGGCAAGTGCCGCCGGAGGAATGG
CTCGAGCCCGCGGTCCGGGTGTTAAACGAGATACTGCCCCGCCGGTTCGCCGCCGACCTG
CTGCCCGTGCTGCGGGCACAGCGGCCCGACCTGGTGGTGTACCAGGCCGGTAACCCGGGA
GCCGGGCTCGCGGCACACCGCGCGGGCATTCCCGCCGTATGCCACGCCAACGCCCGGGCG
GAGGCGATCGACCCGGCAGACCGGTGGCAGCGGCGCGGCATGCAGCTGCTGCGCGCGGTC
GCTGCCGAGAACGGTGTGGAACTGCCCGAGGGGCAGTACCTCCTCGGTGACCGGTACCTG
GACATCTATCCGGACCCGCTGCAGGAAACGTCGTTTGTGGACCGTCCGGAACGGATGTTG
CTGCGCCCGGTGCCCTTCAACGAATCCGGTGAGCTGCCGCAGATCGTCCTGGCCGGACGG
AAACGGCCGCTGGTCTACCTGACGCTGGGCACCGTTCTCGGCACCGCTGCCGCCCTGCGC
GCCGCCGTCGACGGGCTGTCCGCCCTGGACGCCGAGGTGGTGGTGGCGGCCGGGCCGAAC
ATTTCGCTGGCCGATTTCCCTGCCCTGCCCGCTCATGTGCACCTCAAGCAGTGGGTGCCG
CAGGCGGAACTGCTGTCACTGGCCGATCTCGCGGTGCACCACGGCGGTTCCGCAACCACC
CTCGGCGCGGCCGGTTCCGGGGTACCGCAACTGTTCCTGCCCATCGGATTCGACGGGTTC
CTCAACGCCGGCGCGGTCGCGGCGGCCGGTGCCGGCAGGCGGCTGCTGCCCGAGGGGGTC
CAACGATGGGAGGACCGGCGCCGCTGCGATGTCGTCTCCGCCGCGGCCGTCACCGAGGCA
GCCGGCGGGCTGCTGGCCGATCCCGGGGCCAGACAGGCGGCCAAGGCCATCGCCGAGGAG
ATCGCCACCATGCCGAGCCCCGCGGACATCGCGGCCCGGCTCCCCGAGTTCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010610 Domain of unknown function DUF1205 (Domain)
 [181-273]  7e-10 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.269 Signal
Bacteria, Gram-positive   
TMHMM No significant hit