close all open/close all

CDS information : Rubra_00510


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction92,317 / 93,243 / + [in whole cluster]
92,317 / 93,243 / + [in contig]
Location92317..93243 [in whole cluster]
92317..93243 [in contig]
TypeCDS
Length927 bp (308 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-4 O-methyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)rubN7
EC number2.1.1.-
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[23885759] Nitrososynthase-triggered oxidative carbon-carbon bond cleavage in baumycin biosynthesis. (J Am Chem Soc. , 2013)
Related Reference
ACC
Q2I754
PmId
[16632249] Biosynthesis of the terpene phenalinolactone in Streptomyces sp. Tu6071: analysis of the gene cluster and generation of derivatives. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>NDP-hexose C-4 O-methyltransferase [hypothetical protein]
MTGQVHRRYGPSAQWLHINEAHITEEAVADLAGFKSNGVNFKLALWNPQPNGVRYLKALT
FALGMQLSPANRERLQRTRNREVGDPYAVRCNGEPVCLDYLQAVHEVEFMAANLPLDGAR
IMEIGAGYGRTCHTLLSNHEVAGYTIVDLPNTLALSRRYLHTVLEPEQFAKIRFVGVDEV
EEQVRGARFDLCLNIDSFAEMDPGTVGDYLALIDATCAHFYVNNPVGKYIDKTLDGHSQG
AAVVELALNSGLLRDVIDIHDSEAVLQKVPAFVSAYRPGPRWQCVARERAVSWSYYWQAL
YRAGAVPR
selected fasta
>NDP-hexose C-4 O-methyltransferase [hypothetical protein]
ATGACCGGTCAGGTGCACCGGCGTTACGGCCCGAGCGCGCAGTGGCTGCACATCAACGAG
GCGCACATCACCGAGGAGGCCGTGGCCGACCTCGCCGGGTTCAAGTCGAACGGGGTCAAC
TTCAAGCTGGCGCTGTGGAACCCGCAGCCCAACGGCGTGCGCTACCTCAAGGCCCTCACC
TTCGCCCTGGGCATGCAGCTCAGCCCCGCCAACAGGGAGCGGCTGCAGCGCACACGCAAC
CGGGAGGTCGGCGACCCCTATGCGGTGCGCTGCAACGGCGAACCGGTGTGCCTGGACTAT
CTGCAGGCGGTGCACGAGGTCGAGTTCATGGCGGCGAACCTGCCCCTCGACGGCGCCCGC
ATCATGGAGATCGGCGCCGGCTACGGCCGGACCTGTCACACCCTGCTGTCCAACCACGAG
GTCGCCGGATACACGATCGTCGATCTGCCGAACACGCTCGCCCTGTCGCGCCGGTACCTG
CACACCGTGCTGGAGCCGGAGCAGTTCGCGAAGATCCGTTTCGTGGGCGTCGACGAGGTG
GAGGAGCAGGTGCGCGGCGCCCGCTTCGATCTGTGCCTGAACATCGACTCGTTCGCCGAG
ATGGACCCCGGCACCGTAGGGGACTACCTCGCGCTCATCGACGCGACCTGCGCGCACTTC
TACGTCAACAACCCGGTCGGCAAGTACATCGACAAGACGCTGGATGGCCACTCGCAGGGC
GCCGCCGTGGTGGAGCTGGCGCTCAACAGCGGGCTGCTGCGCGACGTCATCGACATCCAC
GACAGCGAGGCGGTGCTGCAGAAGGTGCCCGCTTTCGTGTCCGCCTACCGGCCCGGCCCG
CGGTGGCAGTGCGTGGCGCGGGAACGCGCGGTGTCGTGGAGTTACTACTGGCAGGCCCTG
TACCGCGCCGGGGCGGTGCCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit