close all open/close all

CDS information : Rubra_00520


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction93,240 / 94,229 / + [in whole cluster]
93,240 / 94,229 / + [in contig]
Location93240..94229 [in whole cluster]
93240..94229 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-4 ketoreductase
Product (GenBank)putative 4-Ketoreductase
Gene
Gene (GenBank)rubN6
EC number
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
[16614891] Functional characterization of ketoreductase (rubN6) and aminotransferase (rubN4) genes in the gene cluster of Streptomyces achromogenes var. rubradiris. (Biotechnol Lett. , 2006)

close this sectionSequence

selected fasta
>NDP-hexose C-4 ketoreductase [putative 4-Ketoreductase]
MTAAGDGGHRPLIVVLGGSGFIGAAVVEALARRPVRLRTVGRRPQPVPAGAVADIETVCA
DLTGRAALEAAVAGADTVVHLLMHTADWREAAGNPAAEEVNVGVMRDLVGLLGNTRRPPA
VLFAGSTSQAGLPERMPIDGSEPDRPTTAYDRHKHTAEQILKAADAAGLVRGVSLRLPTV
YGDSPRGRLTGRGVVCTMVRKAFAGEELTLWNDGTVERDLLYVHDAADAFLAGIDHAQVL
AGRHWLLGTGRGVPLGDVLRTIADLVGAHLGRPPVPVVCLPPPDFATATDMHSVTIDSSR
FRAATGWRPRVPLHLALRRCVEAFAHSAR
selected fasta
>NDP-hexose C-4 ketoreductase [putative 4-Ketoreductase]
GTGACGGCCGCGGGGGACGGCGGTCACCGGCCGCTGATCGTGGTGCTGGGCGGTTCGGGC
TTCATCGGCGCCGCAGTCGTCGAAGCCCTCGCCCGGCGCCCGGTCCGGCTGCGCACCGTC
GGCCGCCGCCCGCAGCCGGTGCCGGCCGGCGCGGTGGCCGACATCGAGACGGTGTGCGCC
GACCTCACCGGCCGCGCCGCGCTCGAAGCGGCGGTGGCCGGCGCGGACACGGTGGTCCAT
CTGCTGATGCACACCGCCGACTGGCGTGAGGCCGCGGGCAACCCGGCCGCCGAAGAAGTG
AACGTCGGTGTGATGCGCGACCTCGTCGGCCTGCTCGGCAACACCCGCCGGCCGCCCGCC
GTCCTGTTCGCGGGCTCCACCTCGCAGGCCGGCCTGCCCGAGCGGATGCCCATCGACGGC
AGCGAACCCGACCGGCCCACGACCGCCTACGACCGGCACAAGCACACAGCCGAGCAGATA
CTCAAGGCCGCCGACGCCGCCGGGCTGGTCCGCGGCGTCTCCCTGCGGCTGCCCACCGTG
TACGGGGACAGCCCGCGGGGACGGCTGACCGGCCGCGGCGTGGTCTGCACCATGGTGCGC
AAGGCTTTCGCCGGCGAGGAACTCACCCTGTGGAACGACGGCACCGTCGAACGCGACCTG
CTGTACGTGCACGACGCCGCGGACGCCTTCCTCGCCGGGATCGACCACGCCCAGGTGCTC
GCGGGCCGGCACTGGCTGCTGGGCACCGGCCGCGGCGTGCCCCTGGGCGATGTCCTGCGG
ACGATCGCCGACCTGGTCGGCGCCCACCTGGGGCGGCCGCCGGTGCCCGTCGTGTGCCTG
CCGCCGCCCGACTTCGCCACGGCCACCGACATGCACAGCGTCACGATCGACTCCTCAAGG
TTCCGGGCGGCCACCGGCTGGCGCCCCCGGGTGCCGCTGCACCTCGCGCTGCGGCGCTGC
GTCGAGGCGTTCGCCCACAGCGCCCGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [13-248]  2.80000000000001e-45 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [13-203]  2.3e-26 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-31]  0.767 Signal
Eukaryota   
 [1-24]  0.215 Signal
Bacteria, Gram-negative   
TMHMM
 [12-31]  Transmembrane (i-o)
Transmembrane 1