close all open/close all

CDS information : Rubra_00530


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction95,616 / 94,240 / - [in whole cluster]
95,616 / 94,240 / - [in contig]
Locationcomplement(94240..95616) [in whole cluster]
complement(94240..95616) [in contig]
TypeCDS
Length1,377 bp (458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase
Product (GenBank)putative TDP-glucose-2,3-dehydratase
Gene
Gene (GenBank)rubN3
EC number
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q845B8
PmId
[12889805] Functional identification of rub52 gene involved in the biosynthesis of rubradirin. (Biotechnol Lett. , 2003)

close this sectionSequence

selected fasta
>putative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [putative TDP-glucose-2,3-dehydratase]
MTTATQLAARDDTRLPARLERSRRAVVAGTGMRTQDVDAWLAGRRQAHRFTVERVPLEKI
DGWSFEPGSGNVVHRSGRFFSVEGLDVAIDGRAWQQPIIVQPEVGILGILAKEFDGVLHF
LMQAKMEPGNPGLLQLSPTVQATYSNYTGVHRGADVKYLEYFTRPGRGRVVADVLQSEHG
SWFLCKSNRNMIIETFDEVRPDEDFCWLTLGQIGSLLRRDHVVNMDARSVLACAPMAPAE
AGAVRSDTDVLSWFTNERARHEVRARRIPLAEVSDWVRTEDHIRHVDNRYFRVGGVSVVA
GNREVTSWMQPLLEPVGVGLCAFLVRRFAGVVHLLVHARAEGGLLDTVELGPTVQCTPQN
YAHLPEREQPPFLDLVRRAGADRIRYAALHSDEGGRFHNAVSRCLLVAATEAEAGAEPPP
GFAWVTPGQLHSLARHGHYLNMQARTLLAVVGLLEGLL
selected fasta
>putative dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [putative TDP-glucose-2,3-dehydratase]
ATGACGACCGCGACACAGCTGGCAGCGCGGGATGACACCCGGCTGCCCGCACGGCTGGAG
CGTTCCCGGCGGGCCGTCGTGGCCGGTACGGGCATGCGGACCCAGGACGTCGACGCCTGG
CTCGCCGGGCGCCGCCAGGCGCACCGCTTCACCGTCGAGCGGGTGCCGCTTGAGAAGATC
GACGGCTGGTCGTTCGAACCGGGAAGCGGCAATGTCGTGCACCGCAGCGGGCGGTTCTTC
AGCGTGGAGGGGCTGGATGTCGCGATCGACGGCCGGGCGTGGCAGCAGCCGATCATCGTG
CAGCCCGAGGTGGGGATCCTCGGCATTCTGGCCAAGGAGTTCGACGGTGTCCTGCACTTT
TTGATGCAGGCCAAGATGGAGCCCGGTAATCCCGGCCTGCTGCAGCTCTCGCCGACCGTG
CAGGCCACCTACAGCAATTACACCGGTGTGCACCGGGGCGCCGATGTGAAGTACCTGGAG
TACTTCACGCGGCCGGGAAGGGGCCGGGTGGTCGCCGATGTGCTGCAGTCGGAGCACGGT
TCCTGGTTTTTGTGCAAGTCCAACCGCAACATGATCATCGAGACGTTCGACGAGGTGCGG
CCGGACGAGGACTTCTGCTGGCTCACGCTGGGACAGATCGGCAGCCTGCTGCGCCGTGAC
CATGTCGTGAACATGGACGCGCGCAGTGTCCTGGCCTGTGCGCCGATGGCGCCCGCGGAG
GCGGGCGCGGTGCGCTCGGACACCGATGTGCTGTCGTGGTTCACCAACGAGCGGGCCCGG
CACGAGGTGCGGGCCCGGCGTATCCCGCTGGCCGAGGTGAGCGACTGGGTGCGCACCGAG
GACCACATCCGCCACGTCGACAACCGGTATTTCCGGGTCGGCGGGGTGTCCGTCGTCGCC
GGCAACCGTGAGGTGACCTCGTGGATGCAGCCGCTGCTGGAGCCGGTCGGCGTGGGTTTG
TGCGCGTTCCTGGTCCGCCGCTTCGCCGGGGTGGTGCACCTGCTGGTCCACGCCCGGGCG
GAGGGGGGCCTCCTCGACACCGTCGAACTCGGGCCGACGGTGCAGTGCACCCCGCAGAAC
TATGCCCATCTGCCGGAGCGGGAGCAGCCGCCGTTCCTTGATCTGGTGCGCCGTGCGGGA
GCGGACCGGATCCGCTACGCGGCGCTGCACTCGGACGAGGGCGGCCGTTTCCACAACGCG
GTCAGCCGCTGCCTGCTGGTGGCGGCCACCGAGGCGGAGGCGGGTGCCGAGCCGCCGCCC
GGGTTCGCCTGGGTCACTCCCGGCCAGCTGCATTCGCTGGCCCGGCATGGCCACTACCTG
AACATGCAGGCGCGTACGCTGCTCGCGGTCGTGGGGCTGCTGGAGGGGCTGTTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [33-233]  4.59999999999996e-83 PF03559 [246-450]  4.2e-82 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit