close all open/close all

CDS information : Rubra_00540


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction97,072 / 96,035 / - [in whole cluster]
97,072 / 96,035 / - [in contig]
Locationcomplement(96035..97072) [in whole cluster]
complement(96035..97072) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative TDP-glucose synthase
Gene
Gene (GenBank)rubN1
EC number2.7.7.24
Keyword
  • D-rubranitrose
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative TDP-glucose synthase]
MKALVLAGGSGSRLRPLTLSMPKQLIPVANEPVLRHCLRNIRAMGIRQVGVVEGEHGDQI
RAALGDGAALGLDLTYIRQDTPAGLAHCVRIAAGFLGNEDFVLYLGDNVVVGDLAGAAEE
FRSSRPAAKLLLAKVADPSQYGVAGLRADGNVRAVVEKSPCPPSDLAIMGVYFFTPEICA
AVDRISPSPRGELEITDAIQYLIDAGGTVSAQPFTGLWKDTGTVEGLLACNRLLLDGLPP
NIAGVVDAASVVHGDVTVESGARVTRSVLRGPLVLGAGSVVEDSVLGPYVALGPQCRVRK
AVVRDSILLGGSVVRGGPPVTGEISNGRLRVTAPATSSAEDRSAS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative TDP-glucose synthase]
ATGAAGGCACTCGTGCTGGCCGGCGGGAGCGGTAGCCGGTTGCGCCCGTTGACGCTCTCG
ATGCCCAAGCAGCTGATCCCCGTCGCGAACGAGCCGGTCCTGCGGCACTGCTTGCGCAAC
ATCCGGGCCATGGGCATACGGCAGGTCGGCGTCGTGGAGGGCGAGCACGGCGACCAGATC
CGGGCGGCGCTGGGGGACGGGGCGGCGCTGGGCCTGGACCTCACCTACATCCGGCAGGAC
ACCCCGGCCGGGCTCGCGCACTGTGTCCGTATCGCCGCGGGCTTCCTCGGCAACGAGGAT
TTCGTCCTGTACCTGGGTGACAATGTGGTGGTCGGTGATCTGGCGGGCGCGGCCGAGGAG
TTCAGGTCCAGCCGGCCGGCCGCGAAGCTGCTGCTTGCCAAGGTCGCCGATCCGAGCCAG
TACGGTGTGGCCGGCCTCCGTGCGGACGGCAATGTCCGTGCGGTGGTGGAGAAGTCGCCT
TGCCCGCCGAGCGATCTGGCGATCATGGGTGTCTACTTCTTCACGCCGGAGATCTGTGCC
GCAGTAGACCGGATCAGTCCCAGCCCGCGCGGTGAACTGGAGATCACCGACGCGATCCAG
TACCTGATCGATGCGGGGGGTACCGTCTCCGCGCAGCCTTTCACCGGCCTGTGGAAGGAC
ACCGGCACGGTCGAGGGCCTGCTGGCCTGCAATCGGCTGCTGCTGGACGGGTTACCTCCG
AACATCGCCGGTGTGGTCGACGCGGCGAGTGTCGTGCACGGCGATGTGACGGTGGAGAGC
GGTGCGCGGGTGACCCGCTCCGTGCTGCGCGGGCCGCTCGTCCTCGGCGCGGGCAGCGTG
GTCGAGGACAGCGTCCTGGGCCCGTATGTCGCCCTCGGGCCGCAGTGCCGGGTGCGCAAA
GCCGTCGTGCGGGACTCGATTCTCCTGGGCGGCTCCGTCGTGCGGGGAGGGCCACCGGTC
ACCGGTGAGATATCCAACGGCCGGCTGCGGGTCACGGCACCTGCCACCTCCTCGGCCGAG
GACCGCAGTGCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-235]  2.99999999999998e-48 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-315]  1.69999999999998e-103 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit