close all open/close all

CDS information : Rubra_00550


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction97,618 / 99,207 / + [in whole cluster]
97,618 / 99,207 / + [in contig]
Location97618..99207 [in whole cluster]
97618..99207 [in contig]
TypeCDS
Length1,590 bp (529 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)rubP5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q9KHK2
NITE
Enter_00130
PmId
[11893195] Mutational analysis of the enterocin favorskii biosynthetic rearrangement. (Org Lett. , 2002)
[15505225] EncM, a versatile enterocin biosynthetic enzyme involved in Favorskii oxidative rearrangement, aldol condensation, and heterocycle-forming reactions. (Proc Natl Acad Sci U S A. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative oxidoreductase [hypothetical protein]
MRITATSYTYGGITVAGNLTRRAVLSLTAASTAGAVTGLLGPTGSAAGSTTRRRGTAGWN
ALSRHLDGDLILPSDARYEQAREQSLRQFDTTHPMAIAYCQNTQDVQTVLAFAQDKGIHT
VPRSGGHSFGGYSTTTGIILDVSRLNRVTTDQTLVTIGAGTQQVDALAALTPHGLALASG
LCPTVGAGGFIQGGGIGHQTRKYGMACDRLVSAEVVLADRRAVRASAQDNPDLYWALRGN
GGGNYGVVTSYTLQPIRRTTLTGYRLVWSAGDTATTIENWQQWVTRAPNDLSSLLIAGSA
SPPSPDTMVSIAGTWYGTVEDLDRHIDELVAAVGTNPLNRTVAERSLQQGMMQIYGCATL
TTAQCHRAGTTPESMVPRWNYYRTRSRMFDSTVPPADIEDLLTVLTDPTHMRTGQTRKLY
FEALGGAANEPARTDTAYVHRTTQILAGLTAELPDPAYTSEDTAACENWLADGFAVLDRH
SLPESYQNYMDPALEDWRTAYYAENYPRLARIKHAYDPHGFFRFPRSIS
selected fasta
>putative oxidoreductase [hypothetical protein]
ATGAGAATCACGGCAACGTCTTACACGTATGGGGGAATCACTGTGGCAGGCAACCTCACT
CGCCGTGCTGTCCTGAGCCTGACCGCCGCATCGACGGCCGGTGCGGTGACAGGCCTCCTC
GGGCCGACCGGATCCGCCGCCGGCAGCACCACCCGGCGCCGCGGCACGGCCGGCTGGAAC
GCACTGAGCCGTCACCTCGACGGTGATCTCATCCTGCCGTCGGACGCACGCTACGAACAG
GCCCGCGAGCAGTCACTCCGCCAGTTCGACACCACCCACCCGATGGCCATCGCCTACTGC
CAGAACACACAGGATGTCCAGACCGTCCTGGCGTTCGCCCAGGACAAAGGGATACACACC
GTTCCCCGCAGCGGCGGACACAGTTTCGGCGGCTACTCGACGACGACCGGCATAATACTG
GACGTCTCCCGGCTGAACCGGGTCACCACCGACCAAACACTCGTCACGATCGGGGCCGGC
ACCCAGCAAGTCGACGCGCTGGCAGCCCTCACCCCGCACGGGCTCGCCCTGGCCAGCGGC
CTCTGCCCCACCGTAGGCGCCGGCGGATTCATCCAGGGCGGCGGCATCGGCCATCAGACA
CGCAAATACGGCATGGCCTGCGACCGGCTCGTCTCAGCCGAAGTGGTACTGGCGGACCGG
CGCGCCGTACGCGCCTCGGCCCAAGACAACCCCGATCTGTACTGGGCACTGCGCGGCAAC
GGCGGCGGCAACTACGGCGTCGTCACCAGCTACACACTGCAACCCATACGACGCACCACC
CTGACCGGCTACAGACTGGTCTGGTCGGCAGGCGACACGGCCACAACGATCGAAAACTGG
CAGCAGTGGGTGACAAGGGCACCCAACGACCTCTCCTCGCTGCTCATAGCCGGCTCCGCA
AGCCCCCCCTCACCCGACACCATGGTGAGCATCGCCGGCACCTGGTACGGCACCGTGGAA
GACCTCGACCGCCATATCGACGAACTCGTCGCAGCAGTCGGCACAAACCCCCTCAACCGG
ACCGTCGCAGAAAGATCGCTTCAGCAAGGCATGATGCAGATCTACGGCTGCGCGACCCTC
ACCACCGCACAATGCCACCGGGCCGGCACCACACCCGAATCGATGGTGCCCCGCTGGAAC
TACTACCGCACCCGGTCCCGGATGTTCGACTCAACGGTGCCCCCCGCCGACATCGAGGAC
CTCCTGACAGTCCTGACCGACCCCACGCACATGCGAACCGGACAGACCCGCAAACTGTAC
TTCGAGGCCCTCGGAGGCGCCGCGAACGAACCGGCCCGCACCGACACCGCCTACGTACAC
CGCACCACCCAGATACTGGCCGGACTCACCGCAGAACTGCCCGACCCCGCCTACACCAGC
GAAGACACAGCAGCCTGTGAAAACTGGCTCGCAGACGGCTTCGCCGTCCTCGACCGCCAC
TCCCTGCCCGAAAGCTACCAAAACTACATGGACCCCGCCCTGGAAGACTGGCGGACCGCC
TACTACGCCGAAAACTACCCCCGCCTGGCACGCATCAAGCACGCCTACGACCCGCACGGC
TTCTTCCGCTTCCCCCGCAGCATCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [94-226]  1.6e-30 PF01565
PF01565   FAD_binding_4
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-47]  PS51318
PS51318   TAT
IPR012951 Berberine/berberine-like (Domain)
 [485-528]  1e-15 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [90-258]  PS51387
PS51387   FAD_PCMH
 [59-259]  3.70001063537244e-48 SSF56176
SSF56176   FAD-binding_2
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [74-147]  7.30000000000002e-14 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [148-254]  1.5e-12 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP
 [1-47]  0.841 Signal
Bacteria, Gram-negative   
 [1-38]  0.656 Signal
Eukaryota   
 [1-46]  0.998 Signal
Bacteria, Gram-positive   
TMHMM No significant hit