close all open/close all

CDS information : Rubra_00560


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction100,098 / 99,418 / - [in whole cluster]
100,098 / 99,418 / - [in contig]
Locationcomplement(99418..100098) [in whole cluster]
complement(99418..100098) [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)rubC4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
Q9L9G3
PmId
[18568336] novE and novG act as positive regulators of novobiocin biosynthesis. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative transcriptional regulator [hypothetical protein]
MARSAPRRAGLPLIDAGGGGQNAAGVAVAGPVPARARAGHKGQILTTRVGLRLPAALPFE
TWQAAGRKLFQTADSFAWCLGDWLVYGQDKYGDRYRQAVEAAGLDYQTLRNYAWVARKFD
VSRRHPQLSFQHHAEVAALRPGDQDVWLARAHDNGWSKTELRRRVRAHRGSAERRGLARL
PLVQVESEALTRWQAAAELAGKPFADWVTSALDVAACGTAKHCDAG
selected fasta
>putative transcriptional regulator [hypothetical protein]
ATGGCGCGTTCTGCTCCTCGCCGGGCGGGGCTTCCGCTTATCGACGCTGGAGGCGGCGGT
CAGAACGCGGCCGGCGTGGCTGTGGCCGGGCCGGTGCCGGCCCGGGCGCGGGCTGGTCAC
AAGGGCCAGATCCTCACCACCCGGGTGGGATTGCGCCTGCCGGCGGCGCTGCCGTTCGAG
ACATGGCAGGCGGCCGGCCGGAAGCTTTTCCAGACGGCCGACTCCTTCGCCTGGTGTCTT
GGGGACTGGCTGGTGTATGGGCAGGACAAGTACGGTGACCGGTACCGCCAGGCGGTGGAG
GCGGCCGGCCTGGATTATCAGACGCTGCGTAACTATGCGTGGGTGGCGCGGAAGTTCGAT
GTCTCGCGCCGTCACCCTCAGCTGAGTTTCCAGCACCACGCCGAGGTGGCCGCGCTGCGA
CCGGGTGATCAGGACGTCTGGCTGGCGCGGGCGCATGACAACGGCTGGTCGAAGACAGAG
TTGCGGCGCAGGGTGCGTGCCCACCGGGGCTCGGCGGAGCGCCGGGGTCTTGCCCGGTTG
CCGCTGGTTCAGGTGGAGAGTGAAGCGCTGACGCGCTGGCAGGCTGCCGCCGAGCTCGCC
GGTAAGCCGTTCGCCGACTGGGTCACGAGCGCTTTGGACGTGGCGGCCTGTGGCACGGCG
AAGCACTGCGACGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-9]  0.538 Signal
Bacteria, Gram-negative   
TMHMM No significant hit