close all open/close all

CDS information : Rubra_00570


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction101,614 / 100,355 / - [in whole cluster]
101,614 / 100,355 / - [in contig]
Locationcomplement(100355..101614) [in whole cluster]
complement(100355..101614) [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)rubC5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [putative secreted protein]
MVPRRHAVVIGAGLTGLLAAKVLTEAFTWVTVLEREQVTGGADALDRLPDGRRVCVLAPL
FGDLVEQLLPGFMDLLRAQGAAAGDILSDVRWYLGGQPLRQRETGLTGLSVSQAFLEGVL
RRVLLQCPGVGIVDSCDVTGLMATADGRRVTGVRVHPCGEREQGVDADLVVDASGEASHL
AWLTRLGVAPPRPDTVHLGVSEVVRRYRLPVGVLEGDLAVVVAPTCAVPRSGCLVREERG
RWALSLGSLVGDLPRLGDDRSLLRFAGGLAAGDIREVLGEAEPLGEPAFPYVSGRVCFRY
GSARGLPSGLLLMGLGCVHGDLVGSRAATVAALEALVLREFLGAGGTVSGYRFHHRAWRL
RDRIFARTHAYIPRFSVTLRHLPLSLRLRHRLLDRVVQAAVCDAEAALRLLGAYGLVRW
selected fasta
>hypothetical protein [putative secreted protein]
GTGGTCCCGCGACGGCATGCGGTGGTGATCGGCGCCGGGCTGACCGGTCTGCTGGCCGCG
AAGGTGCTCACCGAGGCATTCACATGGGTGACGGTCCTGGAACGGGAACAGGTGACGGGC
GGCGCCGACGCGTTGGACCGTCTGCCGGACGGGCGCCGTGTCTGCGTGCTGGCGCCATTG
TTCGGCGACCTCGTCGAGCAACTGCTTCCCGGGTTCATGGACCTGCTGCGCGCGCAGGGC
GCCGCGGCCGGCGACATCCTGTCCGACGTCCGCTGGTACCTGGGCGGACAACCGCTCAGA
CAGCGGGAGACCGGGCTGACGGGCCTGTCGGTGAGCCAGGCCTTCCTGGAGGGCGTCCTG
CGGCGCGTGCTGCTGCAGTGCCCGGGCGTCGGCATCGTCGACAGCTGCGATGTCACCGGC
CTGATGGCGACGGCCGACGGCCGCCGGGTGACCGGTGTCCGCGTCCACCCCTGCGGCGAA
CGGGAACAGGGCGTCGACGCCGACCTTGTGGTGGATGCCTCGGGCGAGGCCTCGCACCTG
GCATGGCTGACCCGGCTGGGCGTCGCCCCGCCGCGTCCCGACACCGTCCATCTCGGTGTG
AGTGAGGTTGTTCGGCGTTACAGGTTGCCTGTGGGTGTGCTTGAGGGTGATTTGGCTGTG
GTGGTGGCTCCTACGTGTGCTGTGCCGCGTTCGGGTTGTCTGGTGCGTGAGGAGCGGGGT
CGTTGGGCTTTGAGTCTGGGTAGTTTGGTGGGTGATTTGCCGCGTTTGGGTGACGACCGG
TCTTTGCTTCGGTTTGCCGGGGGTCTTGCGGCTGGGGATATTCGTGAGGTGCTGGGTGAG
GCGGAGCCGCTTGGTGAGCCTGCGTTCCCGTATGTGTCTGGGCGTGTGTGCTTTCGGTAT
GGCAGTGCTCGTGGTCTGCCTTCCGGGCTGTTGCTGATGGGTTTGGGTTGTGTCCACGGG
GATCTGGTCGGTTCGCGGGCTGCGACTGTTGCGGCTTTGGAGGCGTTGGTCCTGCGTGAG
TTCCTCGGTGCGGGGGGCACGGTTTCCGGGTACCGGTTCCATCATCGGGCCTGGCGTTTG
AGGGACCGGATTTTTGCCCGGACGCATGCTTATATTCCCCGGTTTTCTGTCACTTTGCGG
CATTTGCCGTTGTCTTTGAGGCTGCGTCATCGTCTGCTGGACCGGGTTGTGCAGGCGGCG
GTGTGTGACGCGGAGGCGGCTTTGAGGCTGTTGGGTGCGTATGGTCTGGTGCGGTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-26]  0.971 Signal
Eukaryota   
 [1-24]  0.91 Signal
Bacteria, Gram-negative   
 [1-26]  0.823 Signal
Bacteria, Gram-positive   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1