close all open/close all
Rubra_00570 Rubra_00570   last last

CDS information : Rubra_00580


close this sectionLocation

Organism
StrainNRRL 3061 (=NBRC 14000)
Entry nameRubradirin
Contig
Start / Stop / Direction105,268 / 103,001 / - [in whole cluster]
105,268 / 103,001 / - [in contig]
Locationcomplement(103001..105268) [in whole cluster]
complement(103001..105268) [in contig]
TypeCDS
Length2,268 bp (755 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative transcription activator
Gene
Gene (GenBank)rubRg4
EC number
Keyword
Note
  • This ORF product lacks the SARP 2domains (IPR001867 and IPR005158) in the N-terminal region.
Note (GenBank)
Reference
ACC
PmId
[18080113] Biosynthesis of rubradirin as an ansamycin antibiotic from Streptomyces achromogenes var. rubradiris NRRL3061. (Arch Microbiol. , 2008)
Related Reference
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative transcription activator]
MMTTRSGGSTPFSRELEALLAERQLSWRKLAQRVGYTAGWLSKVKNGRPPSEDLARLCDE
ALDAGGRLIALAGGQSVRPQAARTGKAPLAQLPVVTAGFVGRESELAQLDAVLNGPLQPG
TPRTVAIDGPPGVGKTALALRWAHNVAPFFPDGQLYVDLQGYSGNGPDVYPEVVLEKFLF
ALGVPASDIPEGSDERAALYRSLLVGRRVLLILDNAADSGQVEPLLPAASDCAVVITSRS
RLFAMAVRTHATRVTLRPLSRAESHLLLRTVLGPERVAGQMHALDELARLCGRLPLALRI
VAEHAVVDPHLSPEQMLSGLVVEERLLELLSPDDSIAVRAVFSWSYRKLDDDCRRMFRLL
SLHPGTAVSAQAAAALAGWDRAHVVSVLERLHSTHLLERLDGGAYRLHGLLRLYAAERAR
VDENEDERRRAVERLVLWYLRAVTAARGQLAPFRSRLDWLHHESDDDGPGPFCDAEAALR
WCDVELPNFVPVCRLAAEWGCHDVLAAFVLRLFDYLMLRKPWTVWVTSHQLGLEAAEKTG
DQRALAWLKTHLAHARWWLRDRAESGRLYEEAMALHRACGDRCGEAWSLAGMATAARDRG
DPGQAYGLSMRAVRIFEEVGDEEGHAAALAILCDIETQAGKSDAALEAVRHSLRLCEEIR
DHQRLGRGLIKMSGICEFRGDVEQALRYARLAIDLHRSDNDRWSEAGGLVWLGDLLARFG
EKDRATEAWNAALRLYDELGDPRAESLSQELQRTS
selected fasta
>putative transcriptional regulator [putative transcription activator]
ATGATGACCACGCGGTCGGGTGGGAGTACGCCTTTCAGCCGGGAGCTTGAGGCGTTGCTC
GCCGAACGGCAGCTGTCCTGGAGGAAACTGGCTCAGCGGGTCGGTTACACGGCGGGCTGG
CTGAGCAAGGTGAAGAACGGCCGTCCCCCTTCGGAGGACCTGGCCCGCTTGTGTGACGAG
GCCCTGGACGCGGGTGGCCGGCTCATCGCGCTCGCCGGGGGCCAGTCGGTCAGACCGCAG
GCCGCCCGCACCGGGAAGGCGCCTCTTGCCCAGCTTCCCGTGGTCACGGCCGGTTTCGTC
GGGCGGGAGAGTGAACTCGCCCAGCTCGACGCGGTACTGAACGGTCCGCTCCAGCCGGGC
ACGCCGCGGACCGTCGCGATCGACGGTCCCCCCGGTGTCGGCAAAACGGCCCTCGCGCTG
CGCTGGGCGCACAACGTCGCACCGTTTTTCCCGGACGGCCAGCTGTATGTGGATCTCCAG
GGGTATTCCGGCAACGGACCGGATGTCTATCCCGAGGTGGTCCTGGAGAAGTTCCTTTTC
GCGCTGGGCGTCCCGGCGTCGGACATACCGGAGGGGAGCGATGAGAGAGCCGCGTTGTAC
CGCTCGCTGCTGGTCGGCCGGCGGGTGCTGCTGATCCTCGACAACGCGGCCGATTCCGGG
CAGGTGGAACCTCTCCTGCCGGCGGCCAGTGACTGTGCCGTCGTCATCACCAGCCGCAGC
CGCCTGTTCGCGATGGCGGTGCGCACCCATGCCACGCGCGTCACTCTCCGGCCGCTGTCG
AGGGCGGAGTCGCATCTGTTGCTGCGTACGGTCCTCGGTCCGGAGCGGGTCGCGGGGCAG
ATGCACGCGCTCGATGAACTGGCCCGTCTGTGCGGGCGTCTGCCGCTGGCCCTGCGTATC
GTTGCCGAGCACGCGGTGGTGGATCCGCATCTGAGCCCGGAGCAGATGCTGAGCGGCCTC
GTGGTCGAGGAGCGTCTGCTGGAACTGCTCTCGCCGGACGACTCCATCGCGGTGCGGGCG
GTGTTCTCCTGGTCGTACCGCAAGCTCGACGACGACTGCCGCCGGATGTTCCGGCTGCTG
AGCCTGCATCCGGGGACGGCCGTCAGTGCGCAGGCCGCGGCCGCGTTGGCCGGATGGGAC
CGCGCTCACGTTGTCTCCGTGCTGGAGAGGCTGCACAGTACCCATCTGCTGGAACGCCTT
GACGGCGGTGCGTACCGGCTGCACGGGCTGCTGCGCCTGTATGCCGCCGAGCGGGCCCGG
GTGGATGAGAACGAGGACGAGCGCCGTCGGGCCGTGGAGCGGCTGGTGCTGTGGTATCTG
CGGGCGGTCACCGCCGCGCGTGGACAGCTGGCTCCCTTCCGGTCCCGTCTGGACTGGCTG
CACCACGAGTCGGACGATGACGGCCCCGGGCCCTTCTGCGATGCCGAGGCCGCGCTGCGC
TGGTGTGACGTGGAGCTCCCGAACTTCGTGCCCGTGTGCAGGCTCGCGGCCGAATGGGGC
TGTCACGACGTCCTGGCCGCCTTCGTGCTGCGGCTTTTTGACTACCTGATGCTGCGCAAG
CCGTGGACGGTGTGGGTGACCAGCCACCAACTCGGCCTGGAAGCGGCGGAGAAGACGGGC
GATCAGCGGGCGCTCGCCTGGCTCAAGACCCATCTCGCCCATGCCCGCTGGTGGTTGCGC
GACCGCGCGGAGAGCGGGCGGCTGTACGAGGAAGCCATGGCCCTGCACCGGGCGTGCGGG
GACCGTTGCGGGGAGGCCTGGAGTCTGGCGGGCATGGCGACCGCCGCGCGGGACCGCGGT
GACCCCGGGCAGGCCTACGGACTGTCGATGCGGGCCGTGCGGATCTTCGAGGAGGTCGGC
GACGAGGAGGGCCATGCCGCGGCTCTCGCCATACTCTGCGACATAGAGACCCAGGCGGGC
AAGTCCGATGCGGCGCTTGAGGCCGTGCGGCACTCGCTGCGGCTGTGTGAGGAGATTCGC
GACCATCAGCGGCTGGGCCGCGGCCTGATCAAGATGAGCGGTATCTGCGAATTCCGCGGG
GACGTCGAGCAGGCCCTGCGTTACGCGCGGCTCGCGATCGACCTGCACCGTTCGGACAAC
GACCGCTGGAGCGAGGCGGGCGGGCTGGTCTGGCTCGGTGACCTCCTGGCCCGCTTCGGG
GAGAAGGACCGGGCCACCGAGGCGTGGAACGCCGCGCTGCGGCTCTACGACGAACTCGGC
GACCCGCGCGCGGAGAGCCTGTCGCAGGAGCTGCAGCGCACGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [124-139]  3.49999851148921e-08 PR00364 [203-217]  3.49999851148921e-08 PR00364 [291-305]  3.49999851148921e-08 PR00364
PR00364   DISEASERSIST
IPR001387 Helix-turn-helix type 3 (Domain)
 [15-69]  8.50000225010472e-05 SM00530
SM00530   HTH_XRE
IPR002182 NB-ARC (Domain)
 [123-365]  3.60000000000001e-11 PF00931
PF00931   NB-ARC
IPR003593 AAA+ ATPase domain (Domain)
 [121-261]  1.49999977583352e-09 SM00382
SM00382   AAA
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [15-59]  2.6e-05 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
IPR011990 Tetratricopeptide-like helical (Domain)
 [537-744]  5.80000000000004e-20 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
SignalP No significant hit
TMHMM No significant hit
Rubra_00570 Rubra_00570   last last